KEGG   Bacillus subtilis XF-1: C663_3505Help
Entry
C663_3505         CDS       T02459                                 

Gene name
ywrD
Definition
(GenBank) putative gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx00430  Taurine and hypotaurine metabolism
bsx00460  Cyanoamino acid metabolism
bsx00480  Glutathione metabolism
bsx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    C663_3505 (ywrD)
   00460 Cyanoamino acid metabolism
    C663_3505 (ywrD)
   00480 Glutathione metabolism
    C663_3505 (ywrD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsx01002]
    C663_3505 (ywrD)
Enzymes [BR:bsx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     C663_3505 (ywrD)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     C663_3505 (ywrD)
Peptidases and inhibitors [BR:bsx01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   C663_3505 (ywrD)
CD molecules [BR:bsx04090]
 Proteins
  C663_3505 (ywrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AGE65217
UniProt: M4KW90
Position
complement(3547814..3549391)
Genome map
AA seq 525 aa AA seqDB search
MNKSVIGTKQMVVSPHYLASQAGNRILDKGGNAFDAAVAVSACLAVVYPHMTGLGGDSFW
LTFHQETKAVKVYNGSGRSGKNVTRDVYKGKSAIPLRGIDSAITVPGMVDSWDAVLKEYG
RLSLADVLEPARDYAQNGFPVSADQCRHTEKNIELLASTSYTADIFTRRGKAPVPGERFV
QKKLADSLNLIAKKGRSAFYEGDLAQRIVSHLQNNGSYMTIDDFKAHRGEWAAPVSSDYR
GYSVYQAPPNSQGFTGLLTLNILENYDFTQIEHGSFEYYHVLVEALKKSFLDRDAVLTDP
AFADIPLERLLDKRYAKQLAEEIGYLAVPAESRPVGSDTAYAAVIDADGNAVSFIQSLYF
EFGSAITAGDTGILLQNRGSFFSLDENHVNMLEPRKRTFHTLMPAMVCKGGKPKILYGTQ
GGEGQPQTQTAIITRMLDYGMHPQQAISEPRWVWGRTWGEEYEGLRVEGRFTDRTIQKLK
DSGHLVEVVGDYDPLMGHAAAIKVDEEGFLQGGADPRGDGAAVGI
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatctgtcatcggtacaaagcaaatggttgtcagtccgcattacctcgcttct
caagccggaaaccgcatactggataagggaggcaacgcgtttgacgccgctgttgcggtg
agtgcttgtcttgcggttgtgtatccgcatatgactggacttggcggggattccttttgg
ctgacctttcaccaggaaacaaaggcagtaaaagtctacaatggcagcggccgttcagga
aaaaacgtaacgagagatgtatataagggaaaaagcgcgattccgctgcggggaattgac
agtgccattaccgtgccgggaatggttgatagctgggatgcggtcctgaaggagtacggg
cgtctgtctcttgcagatgtactggaacccgcacgcgattatgcccaaaatgggtttcct
gtatcagctgatcagtgtcgtcacacagaaaagaatattgaattgctggcctccacgtct
tacacggctgacatcttcacgagaaggggcaaagcacctgtcccgggagagcggtttgtg
caaaaaaagcttgcagacagtctgaacttgattgctaaaaaaggaagaagcgcattttat
gaaggagatctcgctcagcggattgtctcacatttacagaataacggcagttacatgaca
atcgatgattttaaagcgcatcggggtgagtgggcagcgcctgtatcaagtgattatcga
ggatacagtgtgtatcaggcgccgccgaattctcagggatttaccggtttattgacactg
aacattttggaaaactatgatttcacccaaatcgaacacggttcatttgagtattatcat
gtgcttgtggaggcattgaaaaagagttttctagatcgggatgccgtcctgactgatccg
gcgtttgcagacattccgcttgaaaggcttttggacaaacgttatgcaaaacaattggca
gaagaaatcggctatctcgcagtaccggcagaaagcaggccggtgggaagtgatacggca
tatgcggccgtaatcgatgcggatggcaacgcagtgtcattcatccaaagcctgtacttt
gaatttggctcggcaatcactgccggtgatacaggcatattactgcaaaaccgcggatca
tttttctcactggatgaaaatcatgtcaacatgcttgaaccgagaaagcgtaccttccat
acgctgatgccggctatggtctgtaaaggcggaaagccgaaaattctgtacggtacacaa
ggcggcgaaggccagccgcagacccagacggccatcattacccgaatgctggactacgga
atgcatccacagcaggcaatcagcgaaccgcgctgggtatggggcagaacgtggggagag
gaatacgaaggtctcagagttgagggcagattcacagacagaacaatccaaaaactgaaa
gacagcggacatctcgtggaggttgtcggtgactatgatccgctgatgggacacgcggct
gcaatcaaagttgatgaagaaggctttctccaaggcggagccgatcctcggggagacgga
gcggctgtggggatttaa

DBGET integrated database retrieval system