KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01395Help
Entry
I653_01395        CDS       T02520                                 

Definition
(GenBank) putative dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00030  Pentose phosphate pathway
bsy01100  Metabolic pathways
bsy01120  Microbial metabolism in diverse environments
bsy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    I653_01395
Enzymes [BR:bsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     I653_01395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AGI27549
Position
296561..297337
Genome map
AA seq 258 aa AA seqDB search
MYKDLTGKTAIVTGSSKGIGKAIAERFGQEKMNVVVNYHSDPSGADETLEIIKQNGGKAV
AVEADVSKEEGIQALLDTALEHFGTLDVMVNNSGFNGVEAMPHEMSLEDWQRVIDVNVTG
TFLGAKAALNHMMKNNIKGNVLNISSVHQQIPRPVNVQYSTSKGGIKMMTETLALNYADK
GIRVNAIAPGTIATESNVDTKKEESRQKQLKKIPMKAFGKPEEVAAAAAWLVSEEASYVT
GTTLFVDGGMTLYPSQLE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagatttaaccggaaaaacagcgattgtgacagggtcttcaaaaggaatcggg
aaagccattgcggaacggttcggacaggagaaaatgaatgttgttgtaaactaccacagc
gacccgtctggagccgatgaaactctggaaatcattaagcagaacggagggaaagccgtc
gcagttgaggcggacgtgtcaaaagaagaggggattcaggcgctcttggacacagcttta
gagcatttcggcacgctcgatgtgatggtaaacaactccggttttaacggagttgaggcg
atgccgcatgagatgagtcttgaagattggcagagagtgattgatgtcaatgttaccgga
acctttctgggagcaaaagcagcacttaaccacatgatgaaaaacaatatcaagggcaat
gtgctgaatatctcaagtgttcatcagcagattccgcgcccagtcaacgttcagtattcc
acatccaaaggcggcatcaagatgatgacggaaacgctggcgctcaattatgcggataaa
ggaatccgcgtcaatgcgatagcgcccggcaccattgccacagaatcaaatgttgatacg
aaaaaggaagagagcaggcaaaaacaattgaaaaaaattccgatgaaagccttcggaaag
cctgaagaagtggcggcagcagcagcttggctcgtatctgaggaagcaagctatgtgacc
ggcacaacacttttcgtcgacggcggaatgacactttatccatctcagcttgaatag

DBGET integrated database retrieval system