KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01405Help
Entry
I653_01405        CDS       T02520                                 

Definition
(GenBank) Zn(II)-binding lipoprotein
  KO
K09815  zinc transport system substrate-binding protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy02010  ABC transporters
Module
bsy_M00242  Zinc transport system
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    I653_01405
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsy02000]
    I653_01405
Transporters [BR:bsy02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Zinc transporter [MD:M00242] [OT]
    I653_01405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ZnuA DUF92
Motif
Other DBs
NCBI-ProteinID: AGI27551
Structure
PDB: 

Position
299235..300194
Genome map
AA seq 319 aa AA seqDB search
MFKKWSGLFVIAACFLLVAACGNSSTKGSADSKGDKLHVVTTFYPMYEFTKQIVKDKGDV
DLLIPSSVEPHDWEPTPKDIANIQDADLFVYNSEYMETWVPSAEKSMGQGHAVFVNASKG
IDLMEGSEEEHEEHDHGEHEHSHAMDPHVWLSPVLAQKEVKNITAQIVKQDPDNKEYYEK
NSKEYIAKLQDLDKLYRTTAKKAEKKEFITQHTAFGYLAKEYGLKQVPIAGLSPDQEPSA
ASLAKLKTYAKEHNVKVIYFEEIASSKVADTLASEIGAKTEVLNTLEGLSKEEQDKGLGY
IDIMKQNLDALKDSLLVKS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaatggagcggtttgtttgtgattgcagcgtgctttttattagttgcagca
tgcggcaactcatcaacaaaagggtcggcggattcaaagggtgataaactgcacgttgtc
acaacgttctacccgatgtatgaattcacaaaacaaattgtaaaagacaaaggcgatgtg
gatctgttaatcccatcttccgttgaaccgcatgattgggaaccgacgccgaaagacatt
gccaacattcaggatgctgatttgttcgtttataatagtgaatacatggagacatgggtt
ccgtcagctgaaaaaagcatgggccaaggccatgccgttttcgttaatgcaagcaaaggc
attgatttaatggaaggctctgaagaagaacacgaagagcatgatcatggagagcatgag
cacagtcatgcaatggaccctcacgtatggctcagccctgttctggcacagaaggaagtt
aaaaatattacggcgcaaatcgtgaagcaggacccggataacaaagaatactatgagaaa
aatagtaaagaatatattgcaaaactgcaggatcttgataaactatatcgtacaaccgca
aaaaaagcggagaaaaaagaatttatcacgcagcatacagcttttggctatctggcaaaa
gaatacggcttgaagcaggttccgattgcagggctttcacctgaccaagaaccgagcgca
gccagcttggcaaagctgaaaacatatgccaaagaacataatgtaaaagtcatttacttt
gaagaaattgcatcctcaaaggtcgcagatacgctcgccagtgaaatcggcgcgaagaca
gaagtgctgaatacactggaaggcttgagcaaagaagaacaggataaaggtttagggtat
atcgacattatgaaacaaaacctcgatgccctgaaagattcactattggttaaatcataa

DBGET integrated database retrieval system