KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01430Help
Entry
I653_01430        CDS       T02520                                 

Definition
(GenBank) hypothetical protein
  KO
K05795  tellurium resistance protein TerD
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    I653_01430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TerD
Motif
Other DBs
NCBI-ProteinID: AGI27556
Position
303682..304263
Genome map
AA seq 193 aa AA seqDB search
MTISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSSVFLLDAAGKCASPND
FIFYNQLEGGNGSVVHSGDNLTGAGEGDDENVKVNLSAVPANIDKISFVITIHDAEARSQ
NFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGELYRHNGEWKFSAIGSGYQGG
LARIATDYGLQVG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacaatttcattggcaaaaggacaaaaagtagatttaacaaaaacaaatccgggtctt
tcaaaggttgttgtcggtttaggctgggatacgaacaagtatgacggcgggcacgacttt
gatcttgactcaagtgtgtttctgttagacgctgcaggcaaatgcgcatctccaaacgac
tttattttctacaaccagcttgaaggcggcaacggttcagtcgttcattcaggcgacaac
ctgactggtgctggcgaaggcgacgatgagaatgtaaaagtaaatctcagcgctgtaccg
gcaaacattgataaaatctcatttgttattaccattcacgatgcagaagcgcgcagccaa
aactttggacaagtatcaaacgcgtttgtccgcatcgtaaatgaagaaacaaatgaagag
ctcatccgttacgatcttgcagaagatttctctattgaaacggcaatcattgcaggggag
ctttacagacataacggcgagtggaaattctccgcaatcggctcaggctaccaaggcggc
cttgcccgcattgcaacagactacggtttgcaagtcggttaa

DBGET integrated database retrieval system