KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01520Help
Entry
I653_01520        CDS       T02520                                 

Definition
(GenBank) transcriptional regulator
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_24 HTH_27 HTH_34 TrmB HTH_IclR Fe_dep_repress HTH_AsnC-type HTH_20 Penicillinase_R HTH_11 HTH_5 OTCace_N RP-C DUF4423 HTH_Crp_2
Motif
Other DBs
NCBI-ProteinID: AGI27574
Position
325046..325510
Genome map
AA seq 154 aa AA seqDB search
MSTRNSRSELEKTAVQLFRKLGTRTVLFHQAAAQALGLFPTDLKSADILNEAGPMTAGEL
GKKTGLSTGSVTALVDRLEKAGYVAREKDPNDRRRVVIVPLTASKKHIKDLFRPLSESTM
DLCREYTEEELELIFSFVGKAADIMEEELERLKQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaacaagaaattccagaagtgagttggaaaagactgctgttcagctttttcgaaaa
ctgggcacaagaacggttctgtttcatcaggcagccgctcaagctctcggtctgtttccc
accgatttgaaatcagctgacattttaaatgaagcagggccgatgacggccggagagctg
gggaaaaaaaccggcctcagcacgggttccgtcacggcgcttgttgaccggttggaaaaa
gcggggtatgtggctcgtgaaaaggacccgaacgatcgcaggagagtcgtaatcgtccct
ttgactgcttcgaaaaaacatataaaggatttgttccgtcctctgtctgagtcgacgatg
gatttgtgccgcgaatatacggaagaggagctggaactcattttcagttttgtaggcaaa
gccgccgatattatggaggaagagcttgaacgtctgaaacagtaa

DBGET integrated database retrieval system