KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01545Help
Entry
I653_01545        CDS       T02520                                 

Definition
(GenBank) hypothetical protein
  KO
K09967  uncharacterized protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    I653_01545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1989 DUF3800
Motif
Other DBs
NCBI-ProteinID: AGI27579
Position
328516..329112
Genome map
AA seq 198 aa AA seqDB search
MTQQYIVEPKKGLGLKLKKGQILKVVDVEGQQVADFVAYHAKDFYEHLDQGATIDANHSI
HVKVNDHLYSNLYKPMLTLIEDTVGKHDLLLPACRPDMNRLLYGKQKDEFQDTCYDNMNR
ALEQFGVPKPHMHYPFAIFMNTVLDEKGNLSVETPLSYAGDYVRLRAEMDLIVAFSSCPI
EKGKCNGDSVTSIRVEVS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcaatatattgtggagccgaaaaaagggcttgggctgaagctgaaaaagggg
cagattttaaaggtggttgatgtagaagggcagcaggtggctgattttgtcgcataccat
gccaaggatttttatgaacaccttgatcagggagcgacgatagatgccaatcactccatt
catgtgaaggtcaacgaccatctctactccaacctgtataagccgatgttaaccctgatt
gaagatacggtcggcaagcatgatctgctgctgcccgcctgccgtcctgatatgaacagg
ctcttatatgggaagcaaaaggatgagtttcaggatacgtgctatgacaatatgaaccgt
gcgcttgagcagtttggcgtaccgaagcctcacatgcattacccatttgcgatttttatg
aatactgtccttgatgagaaagggaatctgtctgtggaaacgccgctttcgtatgccgga
gattatgtaaggctcagggcggagatggatttaattgtcgcgttttcttcctgcccgatt
gaaaaagggaaatgcaatggcgacagtgtgacatccatacgggttgaagtcagctga

DBGET integrated database retrieval system