KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01555Help
Entry
I653_01555        CDS       T02520                                 

Definition
(GenBank) ATP-binding membrane protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_18 AAA_33 Zeta_toxin APS_kinase
Motif
Other DBs
NCBI-ProteinID: AGI27581
Position
complement(330110..330709)
Genome map
AA seq 199 aa AA seqDB search
MAMIIWINGAFGSGKTQTAFELHRRLNPSYVYDPEKMGFALRSMVPQEIAKDDFQSYPLW
RAFNYSLLASLTDTYRGIIIVPMTIVHPEYFNEIIGRLRHEGRIVHHFTLMASKETLLKR
LQTRAEGKNSWAAKQIDRCVEGLSSPIFEDHIQTDHLSIQDVAENIAARAELPLDPDTRG
SLRRLADRLMVKLNHIRIK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgatcatttggataaacggggcattcggttccggaaaaacacaaacagccttc
gaactgcacagaaggctgaacccatcttacgtgtatgatcccgagaaaatgggttttgcg
ctgcgctccatggtgccgcaggagatcgcaaaggacgattttcaaagctatcccttatgg
cgggcgttcaattacagtttactagcttctctgacagatacataccgcggcatcattatt
gtgcctatgacgattgtacatcctgaatacttcaatgagatcatcggcaggctcagacat
gaaggcaggatcgttcaccactttacactaatggcttcaaaggaaaccttgttaaaaagg
ctgcaaaccagagcagaaggaaaaaactcatgggccgccaaacaaattgaccgctgcgtt
gaaggtttatcatcacccatttttgaggaccacattcaaacagaccacctgtcgattcag
gatgtggcagagaacattgccgcgagagccgaactcccattagatcctgatacgagaggc
agcctccgaaggctcgccgacagattaatggtaaagctgaatcatatccgcatcaaataa

DBGET integrated database retrieval system