KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01580Help
Entry
I653_01580        CDS       T02520                                 

Definition
(GenBank) hypothetical protein
  KO
K07074  uncharacterized protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    I653_01580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nuc-transf CotH
Motif
Other DBs
NCBI-ProteinID: AGI27586
Position
334533..335315
Genome map
AA seq 260 aa AA seqDB search
MKQRIIDELKRIEQSYGVKIVYAVESGSRAWGFPSQDSDYDVRFIYVPKKEWYFSIEQER
DVIEEPIHDLLDISGWELRKTLRLFKKSNPPLLEWLSSDIVYYEAFTTAEQLRKLRKEAF
KPEASVYHYINMARRNVKDYLQGQEVKIKKYFYVLRPILACQWIEKHGTIPPMDFTVLMN
ELIAEPELKAEMETLLERKRRGEELDLEARIDVIHQFIETEIERIMEAAKELKAEKKDMT
PELNRLLLNTVEEVWKDGGS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaagaatcattgatgaattaaaacggatcgagcagtcatacggagtcaaaatc
gtgtatgccgtcgagtcaggaagccgcgcatggggatttccctcgcaggatagtgattac
gacgtccgctttatttatgtgccgaaaaaggagtggtatttttcaattgagcaggagcgg
gatgtgattgaggaaccgattcacgatttactggatatcagcggctgggagctgagaaag
acgctgcgcctcttcaaaaaatcaaacccgccgctccttgaatggctgtcctcagacatt
gtgtattacgaagcatttacgaccgcagagcagttaagaaaactgcggaaggaggcattt
aagcctgaagcaagcgtgtatcactatatcaatatggcgagaaggaacgtcaaggattat
ctacaaggacaagaggtcaaaattaaaaagtacttctacgttcttcggcctattttggcc
tgccaatggattgaaaagcacggaaccattccgccaatggactttactgttttgatgaat
gaacttattgctgaacccgagctgaaggctgaaatggaaactttgcttgaacggaaaaga
agaggagaagagcttgacctcgaagcaagaatcgatgttattcaccaattcattgaaacg
gaaatcgaaagaatcatggaagcggcaaaagaactgaaggcagagaaaaaagatatgaca
cctgagttgaaccgtttgcttttgaatacggttgaagaagtgtggaaggatggaggaagc
tga

DBGET integrated database retrieval system