KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01605Help
Entry
I653_01605        CDS       T02520                                 

Definition
(GenBank) hypothetical protein
  KO
K08986  putative membrane protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    I653_01605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1980 DUF898
Motif
Other DBs
NCBI-ProteinID: AGI27591
Position
complement(340950..341807)
Genome map
AA seq 285 aa AA seqDB search
MFRLLVLMGFTFFFYHLHASGNLTKYINMKYAYLSFIAIFLLAILTVVQAYLFIKSPEKG
GHHHDHDCGCGHDHEHDHEQNKPFYQRYLIYLVFIFPLVSGIFFPIATLDSSIVKTKGFS
FKAMESGDHYSQTQYLRPDASLYYAQDSYDKQMKQLFNKYSSKKEISLTDDDFLKGMETI
YNYPGEFLGRTIEFHGFAYKGNAINKNQLFVLRFGIIHCIADSGVYGMLVEFPKDMDIKD
DEWIHIKGTLASEYYQPFKSTLPVVKVTDWNTIKKPDDPYVYRGF
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtctattggtgctgatgggatttacgtttttcttttatcatctgcatgcctca
ggaaatctaacaaaatatatcaatatgaaatatgcctatctttcctttattgcgatcttc
ctgctggccattctgacagtcgttcaagcatatctatttatcaagtcgcctgaaaaaggc
gggcatcaccatgaccatgattgcgggtgcggccatgatcacgagcatgaccatgaacaa
aacaagccattttatcagcgttatttgatttatcttgtttttattttccctttagtgtca
ggcatcttcttcccgattgcgacgcttgactcatccattgttaaaacaaaagggttctcg
tttaaggcgatggagagcggagatcactactcccaaacacagtatttgcgtcctgatgcc
agcctgtattacgcgcaagacagctatgacaaacaaatgaaacagctgtttaataagtat
tccagcaaaaaagagatttctctgaccgatgacgatttcctaaaaggaatggaaaccatc
tataactatccgggtgaatttctcggacggacgattgaattccatggatttgcttacaaa
ggaaacgcaattaacaaaaatcagctgttcgtattaaggtttggcatcattcactgtatc
gctgattccggcgtgtacgggatgcttgtggaatttccgaaggacatggacatcaaggat
gatgaatggattcacattaagggcactctggcctcagaatattaccagccatttaagtca
actctccctgtcgtcaaagtaactgactggaataccataaaaaaacctgatgatccgtat
gtttacagaggattttaa

DBGET integrated database retrieval system