KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01730Help
Entry
I653_01730        CDS       T02520                                 

Definition
(GenBank) 3-hexulose-6-phosphate synthase (HPS)
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00030  Pentose phosphate pathway
bsy00680  Methane metabolism
bsy01100  Metabolic pathways
bsy01120  Microbial metabolism in diverse environments
bsy01200  Carbon metabolism
bsy01230  Biosynthesis of amino acids
Module
bsy_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    I653_01730
  09102 Energy metabolism
   00680 Methane metabolism
    I653_01730
Enzymes [BR:bsy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     I653_01730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase PEP_mutase QRPTase_C PRAI 4HFCP_synth Ribul_P_3_epim Abdominal-A
Motif
Other DBs
NCBI-ProteinID: AGI27616
Position
complement(366250..366882)
Genome map
AA seq 210 aa AA seqDB search
MEIQLALDLVNIPEAIELVKEVEQYIDVVEIGTPVVINEGLRAVKEIKEAFPQLKVLADL
KIMDAGGYEIMKASEAGADIITVLGATDDATIKGAVEEAKKQKKKILVDMINVKDIESRA
KEIDALGVDYICVHTGYDLQAEGKNSFEELTTIKNTVKNAKTAIAGGIKLDTLPEVIQQK
PDLVIVGGGITSAADKAETASKMKQLIAQG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggaaatacagcttgcattagacctcgtcaacatcccagaagccattgagctagtcaaa
gaggtagaacaatacatcgacgtagttgaaatcggaacaccggtcgtcattaatgaaggc
ctaagagccgttaaagaaataaaagaagcatttcctcaattgaaggttcttgcagacctg
aaaatcatggatgccggaggctacgaaattatgaaagcgtcggaagcaggcgctgacatc
atcaccgttttaggtgctacagacgatgcaacgattaaaggcgcagtagaagaagccaaa
aaacaaaagaagaaaatcttagtggacatgattaacgtgaaagatatcgaatcccgtgcg
aaagaaattgacgcactcggtgttgactacatctgcgtccacactggctatgatcttcaa
gcagagggtaaaaactctttcgaagaattaacgacaatcaaaaataccgtaaaaaacgca
aaaaccgcaatcgcggggggcatcaaacttgatacattgccagaagtgatccagcaaaag
cctgaccttgtcattgttgggggcggaattacaagcgcagctgataaggcagaaacagct
tcaaaaatgaagcagcttattgcccaaggataa

DBGET integrated database retrieval system