KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01900Help
Entry
I653_01900        CDS       T02520                                 

Definition
(GenBank) hypothetical protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_3 HATPase_c_5 Vac_Fusion Caudo_TAP DUF4164
Motif
Other DBs
NCBI-ProteinID: AGI27645
Position
418331..419749
Genome map
AA seq 472 aa AA seqDB search
MKIKYLYQLLLSHISILILAFVIIISLFSHFVKEFAYQNKVEELTSYAVQIANEFQAGQV
DMRRLYPYQDMLSTRKTQFIIFNEEQQPYFLPEGFHHPPREQLKKSEWNKLKKGQTVMIR
ADGRFDDEVSLVAQPIFVQNEFKGAVLLISPISGVEQMVNQVNLYMFYAVISTLVITILV
SWLLSKFHVKRIQKLREATDKVASGDYDIHLENSYGDEIGVLASDFNIMAKKLKQSRDEI
DRLEKRRRQFIADVSHELKTPLTTINGLVEGLNSHTIPEDKKDKCFSLISEETKRMLRLV
KKNLDYEKIRSQQITLNKLDVPLIEVFEIVKEHLQQQAEEKQNKLMIQVEDHVIVHADYD
RFIQILVNITKNSIQFTQNGDIWLRGMEGYKETIIEIEDTGIGIPKEDIEHIWERFYKAD
ISRTNTAYGEYGLGLSIVKQLIEMHQGTVEIESEEGKGTKFIIRLPLTAKQQ
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaagattaaatatttatatcagctgctgctaagccacatcagcattttgattttagca
tttgtcattatcatttctctgttttcccactttgtgaaggaatttgcctatcaaaacaaa
gtagaggaattgacgtcatatgcggtgcagattgcaaatgaattccaagctggccaggtg
gacatgcgcaggctctatccttatcaggacatgttaagcacaagaaagacgcagtttatc
atctttaatgaagagcaacagccttattttcttcctgaaggctttcatcacccaccaagg
gaacagctgaagaaatcagaatggaataagctaaaaaaagggcagactgtcatgatcagg
gcagatggccgttttgatgatgaagtgtcacttgtggcgcagcctatatttgttcagaac
gaatttaaaggcgccgttctgctgatttctccgatcagcggcgttgaacagatggtcaat
caggtcaatctctatatgttttacgctgtgatcagcacgcttgtgattacgattctcgtg
agctggcttctgtccaaattccatgtcaagcggattcaaaaactgagagaagcgacagat
aaagtggcttccggcgattatgacatccatttggaaaacagctacggggacgaaatcggc
gtactggcgtctgactttaatatcatggcgaaaaaactaaagcagtcaagggatgaaatc
gatcgcctcgagaagcggagaaggcagtttatcgctgacgtgtcacatgaattaaaaaca
ccgctgacgacgatcaacggtttggttgaagggctgaacagccatacgattcctgaggat
aagaaggataaatgcttctcgctgatcagtgaggaaacgaagcgcatgctgcggctcgta
aaaaaaaatctggattatgaaaaaatcagatcccagcaaattaccttgaacaagctagac
gttcctctgatcgaggtgtttgaaatcgtgaaagagcacttgcagcagcaggcggaagaa
aaacaaaacaagctgatgatccaagtagaggatcacgtcatcgtacatgccgattatgac
cggttcattcaaattctcgtcaacattacgaaaaacagcatccaatttacgcaaaacggt
gacatttggctgcgcggaatggaaggttataaagagacgattattgaaattgaagacacg
ggtatcggcattccaaaagaggatattgagcatatatgggagcgattctataaagcagat
atttcaagaacgaacacggcatacggtgaatacggactcggtctctcgatcgtcaagcag
ctcattgaaatgcaccagggcacagtagaaatcgagagtgaagaagggaaaggcacaaag
tttatcatccgccttcctttaacggcaaaacagcaatag

DBGET integrated database retrieval system