KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01905Help
Entry
I653_01905        CDS       T02520                                 

Definition
(GenBank) response regulator aspartate phosphatase
  KO
K06361  response regulator aspartate phosphatase C [EC:3.1.-.-]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    I653_01905
Enzymes [BR:bsy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     I653_01905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_12 TPR_1 TPR_2 TPR_8 TPR_16 TPR_10 TPR_6 TPR_7 TPR_14 ANAPC3
Motif
Other DBs
NCBI-ProteinID: AGI27646
Position
419913..421061
Genome map
AA seq 382 aa AA seqDB search
MKSGVIPSSAVGQKINEWYRYIRTFSVPDAEVLKAEIQQELKHMQHDSNLLLYYSLMEFR
HQLMLDYLEPLEKLNIEDQPSLSELSRNIDSNQADLKGLLDYYVNFFRGMYEFDKREFIS
AITYYKQAEKKLSFVADHIERAEFYFKIAEAYYYMKQTYFSLINIKNAYEIYVEQETYNV
RIIQCHFVFGVNLMDERNFEQAARHFKLALNMAQAEQKAQLVGRAYYNLGLCYYNQDLLD
PAIDYFEKAVSTFESSRIVNSLPQAYFLITLIYYKQGKHDKASEYHKRGYEYAKETDDAD
YAVKFEFLQSLYQDQPNEEGIERCFQYLKNKNMYADIEDLALEVAKYYYEQKWFKLSASY
FLQVEEARKQIQRSEGLYEIEI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcggggtaattccttcttcagcggtcggtcaaaaaattaacgagtggtacaga
tatatccggacattcagcgtgccggatgccgaagtgttaaaagctgaaatccagcaggaa
ctgaaacacatgcagcatgattccaacttgctgctttattattcactaatggaattccgg
caccagcttatgctggattatcttgagccgttagagaaattaaatatcgaagaccagcca
agcctgtctgaattatcaagaaacattgacagcaaccaggcagatctcaaagggctgctc
gactattacgtgaatttttttcgcgggatgtatgagtttgataagcgggaatttatttct
gccattacatactataaacaggcggagaaaaagctctcctttgtcgcagaccatattgaa
cgggctgaattctattttaaaatcgcggaagcttattattatatgaagcaaacgtatttt
tcattgattaatataaaaaacgcttatgaaatttacgtggagcaggaaacctataatgtg
agaatcattcaatgccatttcgtgttcggggtcaacctgatggatgaaagaaatttcgaa
caagccgcacgccatttcaaattggcgctcaatatggcccaagcggaacaaaaagcccag
ctggtcggaagagcatactacaatctcggattatgctattacaatcaagaccttctagac
cctgccattgattactttgaaaaagcggtctccacgtttgaaagcagcaggatcgtcaat
tctctcccgcaagcctattttttaatcaccctgatttattataaacagggaaaacatgat
aaagcttcggaatatcacaagcggggctatgaatatgctaaagaaacagacgatgcagac
tatgccgtaaaattcgagtttttgcaatccctatatcaggatcagcccaatgaagaagga
atcgaacgatgtttccaatacttaaaaaataaaaatatgtacgctgatatagaggattta
gccctagaagtagcaaaatactactatgaacagaaatggtttaaactgtctgcttcctat
tttctacaagttgaagaggcaagaaaacaaatacaaaggagtgaaggtttgtatgaaatt
gaaatctaa

DBGET integrated database retrieval system