KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01925Help
Entry
I653_01925        CDS       T02520                                 

Definition
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00260  Glycine, serine and threonine metabolism
bsy00261  Monobactam biosynthesis
bsy00270  Cysteine and methionine metabolism
bsy00300  Lysine biosynthesis
bsy01100  Metabolic pathways
bsy01110  Biosynthesis of secondary metabolites
bsy01120  Microbial metabolism in diverse environments
bsy01130  Biosynthesis of antibiotics
bsy01210  2-Oxocarboxylic acid metabolism
bsy01230  Biosynthesis of amino acids
Module
bsy_M00017  Methionine biosynthesis, apartate => homoserine => methionine
bsy_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
bsy_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    I653_01925
   00270 Cysteine and methionine metabolism
    I653_01925
   00300 Lysine biosynthesis
    I653_01925
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    I653_01925
Enzymes [BR:bsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     I653_01925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT_7 ACT DEK_C
Motif
Other DBs
NCBI-ProteinID: AGI27650
Position
complement(421704..423068)
Genome map
AA seq 454 aa AA seqDB search
MKVVKFGGSSLASGAQLDKVFHIVTSDPARKAVVVSAPGKRYAEDTKVTDLLIACAKQYL
ETGSAPELAEAVVERYALIANELQLGQSIIEKIRDDLFTLLEGDKSNPEQYLDAVKASGE
DNNAKLIAAYFRYKGVKAEYVNPKDAGLFVTNEPGNAQVLPESYQNLYRLRERDGLIIFP
GFFGFSKDGDVITFSRSGSDITGSILANGLQADLYENFTDVDAVYSVNPSFVQNPKEISE
LTYREMRELSYAGFSVFHDEALIPAFRAGIPVQIKNTNNPSAEGTRVVSKRDNTNGPVVG
IASDTGFCSIYISKYLMNREIGFGRRALQILEENGLTYEHVPSGIDDMTIILRQGQMDAV
TERSVIKRIEEDLHADEVIVEHHLALIMVVGEAMRHNVGTTARAAKALSEAQVNIEMINQ
GSSEVSMMFGVKEAEERKAVQALYQEFFAGVLIS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgttaaattcggaggcagctcacttgcttcaggcgcccagcttgacaaggtg
tttcacatcgttacctcagacccggcacggaaagctgtagtcgtttcagctccgggaaaa
cgctatgccgaggatacgaaagtgactgatctcttaatcgcatgtgcaaaacaatatttg
gaaacaggcagcgcacctgaactggcggaagctgttgtggaacggtacgctctcatcgcc
aatgagcttcagctggggcaaagcattatcgaaaaaatcagagatgatctgtttacgctt
ttagaaggagataaaagcaatcccgagcaataccttgacgcagtcaaggccagcggggag
gataacaatgccaagctgattgccgcttatttccgctataaaggcgtcaaagcggaatat
gtaaacccgaaggatgccggcctctttgtgacaaatgaacccggcaacgcgcaagttctt
cctgaatcctatcaaaacctctatcgtcttcgggaacgtgacggactcatcatttttccc
ggttttttcggattcagcaaggatggcgatgtgatcacattctcacggagcggttctgat
attaccggttcgattcttgccaacggacttcaagccgatttgtacgaaaactttacagac
gtagacgctgtgtattctgtcaatccgtccttcgttcagaatccaaaggaaatcagcgag
ctgacatacagagagatgcgggagctgtcctacgcgggtttttcagtgtttcatgatgaa
gcgctcattccggcattcagagcggggattcctgttcagatcaaaaatacgaacaacccc
tcagccgaaggcacccgcgtcgtcagcaagcgggataacacaaacgggcctgtcgtcggc
attgccagcgacactggtttttgcagcatttatatcagcaagtatctcatgaacagagaa
atcggttttggccgcagagcccttcaaatcctggaggagaatggtttgacgtatgagcat
gttccatcgggaatcgatgacatgacgatcattttacggcaggggcaaatggatgccgtc
actgagcgcagcgtcatcaaacggatcgaagaggatttgcatgccgatgaagtcatcgtc
gagcatcatctcgccctgattatggttgtaggggaagcgatgcgccacaatgtcggtaca
acggcaagagccgccaaagcattatcagaggcacaggtgaatatcgaaatgatcaatcag
ggatcttctgaagtaagcatgatgtttggcgtaaaagaagccgaagaaagaaaagccgtt
caagcgttataccaggaatttttcgcgggcgtgctgatctcttaa

DBGET integrated database retrieval system