KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01945Help
Entry
I653_01945        CDS       T02520                                 

Definition
(GenBank) putative iron-siderophore ABC transporter
  KO
K02016  iron complex transport system substrate-binding protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy02010  ABC transporters
Module
bsy_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    I653_01945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsy02000]
    I653_01945
Transporters [BR:bsy02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    I653_01945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2 Inhibitor_I53 DUF3740
Motif
Other DBs
NCBI-ProteinID: AGI27654
Position
426117..427070
Genome map
AA seq 317 aa AA seqDB search
MKKFALLFIALVTAVVISACGNQSTSSKGSDSKEEQITVKHQLDKNGTKVPKSPKKVVVF
DFGSLDTLDKLGLDDKVAGLPKQALPKYLSKFKDDKYADVGSLKEPDFEKVADLDPDLII
ISGRQSESYKEFSKIAPTIYLGVDTAKYMESFKSDAETIGKIFDKEDEVKDELAKIDHSI
ADVKKTAEKLNKNGLVIMANDGKISAFGPKSRYGLIHDVFGVTPADKNIKASTHGQSVSY
EYISKTNPDYLFVIDRGTAIGETSSTKQVVENDYVKNVNAVKNDHVVYLDSATWYLSGGG
LESMAQMIKEVKDGLDK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttcgcattactattcatcgctttggtgacggcagttgtgatttctgcatgc
ggaaaccaaagcacaagcagcaaaggttctgattctaaggaagaacaaatcacagtgaaa
caccagctggacaaaaacggaacaaaagtaccgaagagccctaaaaaagttgtcgtattt
gactttggaagcttagatacactagataaacttggtcttgatgataaagtagcgggactg
ccgaaacaagcccttcctaaatatctgtccaaattcaaggatgacaaatatgctgacgtc
ggaagcttaaaagagccagacttcgagaaagtggcagatttagaccctgacttgatcatt
atctcaggaagacaatctgagtcttacaaagaattctctaaaattgcgccgacaatttac
cttggcgtagacacagcgaagtatatggaatcatttaagtctgacgcagaaacaatcggt
aagatcttcgataaagaagatgaagtgaaggatgaactcgcaaaaatcgatcattcaatc
gcagatgtaaagaaaacggctgaaaagcttaacaaaaacggtctcgtcatcatggcgaac
gatgggaagatcagcgcattcggtcctaaatcaagatacggcctgatccatgacgtgttc
ggcgtgacaccggctgataaaaacatcaaagcgtctactcacggacaaagtgtttcttac
gagtacatttcaaaaacaaacccggattacctgtttgtcattgaccgcggtacagcgatc
ggtgaaacatcatctactaaacaagtcgttgaaaatgattatgtgaaaaatgtaaacgca
gtgaaaaatgatcatgtcgtctaccttgattctgctacttggtacttatcaggaggcggt
cttgagtctatggcgcaaatgatcaaagaagtgaaagacggtttagataagtaa

DBGET integrated database retrieval system