KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01985Help
Entry
I653_01985        CDS       T02520                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00250  Alanine, aspartate and glutamate metabolism
bsy00310  Lysine degradation
bsy00350  Tyrosine metabolism
bsy00650  Butanoate metabolism
bsy00760  Nicotinate and nicotinamide metabolism
bsy01100  Metabolic pathways
bsy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    I653_01985
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    I653_01985
   00310 Lysine degradation
    I653_01985
   00350 Tyrosine metabolism
    I653_01985
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    I653_01985
Enzymes [BR:bsy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     I653_01985
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     I653_01985
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     I653_01985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF4371 DUF1487
Motif
Other DBs
NCBI-ProteinID: AGI27662
Position
434030..435418
Genome map
AA seq 462 aa AA seqDB search
MPDQLTVYNPATGEEIKTIPQQSATEVEEAIERSHQAFKTWSKTSANERASLLKKWYELI
VEHKEELADLITKENGKPYQEAVGEVLYGAGYIEWFAEEAKRVYGRTVPAPTTGKRIVVT
RQPVGPVAAITPWNFPNAMITRKAAPALAAGCTFIIKPAPDTPLSAYELARLAYEAGIPK
DVLQVVIGDGEEIGNVFTSSPKIRKITFTGSTPVGKILMKNSADTVKHVSMELGGHAPLI
VDEDADIDLAVEQAMASKYRNAGQTCVCANRLIVHESIKDEFAAKLSEQVSKLKVGNGLE
EGVNVGPIINKRGFEKIVSQIDDAVEKGAKVIAGGTYDRNDDKGCYFVNPTVLTDVDTSM
NIMHEETFGPVAPIVTFSDIDEAIQLANDTPYGLAAYFFTENCRRGIYISENLEYGSIGW
NDGGPSAVQAPFGGMKESGIGREGGSEGIEPYLETKYLSIGL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgccagatcaattaacggtctacaacccggctacgggcgaggagatcaaaacgattcct
cagcaatcagccacagaggtagaagaagccattgaacgttcacatcaagcgtttaaaacg
tggtctaaaacatcagcgaacgaaagagcgtctcttttgaaaaaatggtatgagctgatt
gttgaacataaagaagagcttgcagatttaattacaaaggaaaacggaaaaccataccag
gaagcagtcggcgaggtactttacggcgcaggctatatcgaatggttcgcagaggaagcg
aagcgtgtgtacggaagaacggtcccggccccgacaactggtaaacgaattgttgtcaca
cgccagccggtcggccccgttgctgctatcacgccctggaatttcccgaatgcgatgatt
acacgcaaagcggcgcctgctcttgccgctggctgtacatttatcatcaagccggcgcca
gacacaccgctgtctgcttatgaactagcgcgcctcgcatatgaagctggcattccgaag
gatgttcttcaggttgtgatcggtgatggagaagaaatcggaaatgtgttcacaagcagt
ccgaaaatccgcaaaatcacgtttacaggctcaacacctgtagggaaaatccttatgaaa
aacagcgcggacaccgtgaagcacgtctcaatggaactcggcggacatgccccgctgatc
gtagatgaagatgcagacattgaccttgccgttgaacaggcgatggcgtccaaataccga
aacgccggccaaacctgcgtatgtgccaaccgcctgatcgttcatgagtccatcaaggat
gaatttgctgcgaaactgagcgagcaagtgtctaagctgaaagtcggaaatggacttgag
gaaggcgtcaatgtcggaccgatcatcaacaaacgaggcttcgaaaaaatcgtcagccaa
atagatgatgcggttgaaaaaggcgcaaaagtgattgctgggggcacatatgaccgaaac
gatgacaaagggtgctactttgtgaatccgacagtgctcaccgatgtcgatacgtccatg
aacatcatgcatgaggaaacattcggcccggtcgccccgatcgtcacgttttctgatatt
gatgaagcgattcagcttgccaacgatacaccgtatggcttggctgcatacttcttcaca
gaaaactgccgccgcggcatctatatttccgagaatctagagtatggcagtatcggctgg
aatgacggcggaccgtcagcggttcaagcgccattcggcggaatgaaagaaagcggcatt
ggccgtgaaggcggttcagaaggtatcgagccgtaccttgaaacaaaatatttgtccatc
ggtttataa

DBGET integrated database retrieval system