KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_02015Help
Entry
I653_02015        CDS       T02520                                 

Definition
(GenBank) putative transcriptional regulator
  KO
K21601  DeoR family transcriptional regulator, copper-sensing transcriptional repressor
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Brite
Transcription factors [BR:bsy03000]
 Prokaryotic Type
  Helix-turn-helix
   DeoR family
    I653_02015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_DeoR HTH_11 MarR NosL HTH_23 HTH_22 TrmB HTH_28 HTH_7 HTH_IclR GntR DUF1670 HTH_5 HTH_24 HTH_AsnC-type HTH_20 Mga MarR_2
Motif
Other DBs
NCBI-ProteinID: AGI27668
Position
complement(439541..440113)
Genome map
AA seq 190 aa AA seqDB search
MLPINRQQHILKWLKEEGALRISDISAKFGVSEMTVYRDVNQLVQSNQVIKTAGGITLPA
RTPQTDHMCSYCLKPVNQAHSVQLITVNQDIEQLCCAHCAFLRYADKTEEVSHLICRDFL
LQTTVSAGSAYFVVNAELNLHCCQPQAIPFATLDHAERFQKGFGGAVRTFDQALEDMLQD
RKKRCTCTKK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgcttccgattaatagacagcaacacatactgaagtggctgaaagaagaaggcgcgctc
agaatttctgacatcagcgcaaagtttggcgtttcggaaatgacggtatacagagatgtc
aatcagctggttcagtcaaatcaggtcattaaaacggccggcggcatcacgctccccgcc
agaacacctcaaacggatcatatgtgcagctattgcttgaagcccgtcaatcaagctcat
tcggttcagctgattacggtaaaccaagacattgaacagctatgctgcgcacattgcgcg
tttttgcgttacgcggataaaacggaagaggtttcacacttgatttgcagagactttctg
ttacagacaaccgtcagtgccggttcggcttatttcgtcgtaaatgctgaattaaacctg
cactgttgccagccgcaggccattccgtttgcgacacttgaccatgccgaacgatttcaa
aaaggattcggcggagccgtccgcactttcgaccaagcgctggaagacatgcttcaagac
agaaagaaacgctgcacctgcaccaagaaataa

DBGET integrated database retrieval system