KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_02050Help
Entry
I653_02050        CDS       T02520                                 

Definition
(GenBank) putative hydrolase
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DLH PE-PPE DUF726 Hydrolase_4 Abhydrolase_2 Lipase_2
Motif
Other DBs
NCBI-ProteinID: AGI27675
Position
complement(445740..446348)
Genome map
AA seq 202 aa AA seqDB search
MSPKPLVILAHEIYGVNSSMKKMGRLIKMAGYDVLTPNLLGEDEVYTLQEEKTAYEQFTK
HERLKTGETIIQNVIRQNAGRHIFVIGFSVGATIAWKCSSMPEVSGSVCYYGSRIRDSLH
HVPACPVLLFFPNYEPSFDVALLIKKLREKQHTHLEIYQFDALHGFANPDSVYFNRTLFF
QTLSIIKNGAEKRLRPVSSEIY
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtccccaaaaccgcttgtcattctcgcacacgaaatatacggtgtaaacagcagtatg
aaaaagatgggccggctgatcaaaatggctggatatgatgtgttgacgcccaacctgctc
ggcgaagatgaagtctacacactgcaagaagaaaaaacggcatacgaacaatttacaaaa
cacgaacggctgaaaacgggagaaaccatcatccagaatgtgatcaggcaaaacgccgga
cggcacatctttgtgattggattcagcgtgggggctactatcgcatggaaatgcagcagt
atgcctgaggtgagcggatcggtttgttattacggttcccggatacgcgactctcttcat
cacgtgccagcctgcccggtcctattgtttttccctaattatgagccgtcgtttgacgta
gcgcttcttattaaaaaactgcgggaaaaacagcatacccatcttgagatttatcaattc
gatgcgcttcacggcttcgccaatcctgattctgtttatttcaacaggacccttttcttc
caaacgctttctatcataaaaaacggggcggaaaaacggctccgccctgtttcatcagaa
atttattaa

DBGET integrated database retrieval system