KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_02145Help
Entry
I653_02145        CDS       T02520                                 

Definition
(GenBank) hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    I653_02145
Enzymes [BR:bsy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     I653_02145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Lyx_isomer ARD Cupin_1
Motif
Other DBs
NCBI-ProteinID: AGI27694
Structure
PDB: 

Position
463673..464176
Genome map
AA seq 167 aa AA seqDB search
MGITKEEVNSYYQKAGIVLTDEEVDQIQLMDYGLGKERKVGLQLFVYVNTDRYCSKELVL
FPGQTCPEHRHPPVDGQEGKQETFRCRYGKVYLYVEGEKTPLPKVLPPQEDREQYTVWHE
IELEPGGQYTIPPNTKHWFQAGEEGAVVTEMSSTSTDKHDIFTDPRI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcacgaaagaagaagtgaacagctactatcaaaaagcagggattgtattaacg
gacgaggaagtagaccaaatccagctgatggattacggcttaggaaaagaaagaaaagtc
gggctccagctcttcgtctacgtcaatacagaccgttattgctcaaaggaattggtgctg
tttccgggacagacttgcccggaacaccgccatccgccggtcgacggccaggaaggtaag
caggagaccttccgctgccgctacggaaaagtgtatctttacgtagaaggagaaaaaacg
ccgcttccaaaagttctccctcctcaggaagacagagaacaatatacggtctggcacgaa
attgagctagaaccgggcgggcaatacacgattccaccaaacacaaagcattggttccag
gccggggaagaaggtgccgtcgtgacggaaatgtcatcaacgagcacggataaacatgat
atctttaccgatccaagaatataa

DBGET integrated database retrieval system