KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_05235Help
Entry
I653_05235        CDS       T02520                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00071  Fatty acid degradation
bsy00072  Synthesis and degradation of ketone bodies
bsy00280  Valine, leucine and isoleucine degradation
bsy00310  Lysine degradation
bsy00362  Benzoate degradation
bsy00380  Tryptophan metabolism
bsy00620  Pyruvate metabolism
bsy00630  Glyoxylate and dicarboxylate metabolism
bsy00640  Propanoate metabolism
bsy00650  Butanoate metabolism
bsy00900  Terpenoid backbone biosynthesis
bsy01100  Metabolic pathways
bsy01110  Biosynthesis of secondary metabolites
bsy01120  Microbial metabolism in diverse environments
bsy01130  Biosynthesis of antibiotics
bsy01200  Carbon metabolism
bsy01212  Fatty acid metabolism
bsy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I653_05235
   00630 Glyoxylate and dicarboxylate metabolism
    I653_05235
   00640 Propanoate metabolism
    I653_05235
   00650 Butanoate metabolism
    I653_05235
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I653_05235
   00072 Synthesis and degradation of ketone bodies
    I653_05235
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I653_05235
   00310 Lysine degradation
    I653_05235
   00380 Tryptophan metabolism
    I653_05235
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I653_05235
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I653_05235
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I653_05235
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsy04147]
    I653_05235
Enzymes [BR:bsy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I653_05235
Exosome [BR:bsy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I653_05235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGI28305
Position
complement(1074189..1075283)
Genome map
AA seq 364 aa AA seqDB search
MNAVIVDAKRTIFGNQNGLLKPFLPEDLAAPIIRCLSRKLEDQIDEVILGNATGRGGNLA
RLSALQAGLPLSVPGMTIDRQCGSGLEAVRYACSLIQAGAGTMYIAGGSESSSQSPFSER
ARFSPDAIGDPDMGIAAEYTAARYSISRNMQDEYALLSHQRSRNAHDGGFYREEIVPLGE
LETDEAFLKTRPIKAIIPRAKPVFDTSSGTVTAANSSGIADGAAALLVMKEEKAAALGLK
PVLRFIGSAVSGIHPNYPPAAPVDAIRNLLHTHDVTPDDIGLFEINEAFAVKICVCSQEL
GIPFSKINVRGGALALGHPYGASGAALVTRLFYEAKRRTDCQYAVAAIGSGGGNGLALLF
EVLA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgttattgttgatgcaaaacgaacgatctttggaaatcaaaacggactgctg
aagcccttcctgccggaggatttggcggctcccatcatccgctgtctcagccgaaagcta
gaggatcaaattgacgaggtcattctcggaaatgctaccggcagaggcggcaacctcgcc
agactgtcagcccttcaagccggactgcctttatcggttcccggaatgacaattgacaga
cagtgcggctccggccttgaagctgtgcgctatgcctgcagccttattcaagcgggagcc
ggcacgatgtatatcgcgggcggctcagaaagcagcagccaatcccctttttcagaacgg
gcccgcttttctccagatgccatcggcgatcccgacatgggaatcgcagcagaatatacg
gcagcacgttattccatcagcagaaacatgcaggatgagtacgcgcttctcagccatcaa
cgcagcaggaacgcgcatgatggaggattttaccgtgaagaaattgttcctctcggggaa
ttggagacagacgaagcatttttgaaaacacgtccgataaaagcgattattccccgcgca
aagccggttttcgacaccagctccggaacagtcacagcagccaacagcagcggcatagca
gacggagcagcggctcttttggtaatgaaagaagaaaaagcggcagccctgggacttaag
cctgtgctccggtttatcggcagcgcagtcagcgggattcatcccaactatccgcccgcg
gctccggttgatgcgatccgtaatctcttacatacacacgatgtaacacctgatgatatc
ggtttatttgaaatcaatgaagcctttgccgtcaaaatttgtgtctgctcgcaagaactc
ggcattcccttttcaaaaatcaatgtgcgcggcggcgcattagctcttggccatccatac
ggtgcatcaggtgcagctctggtaaccagattgttttatgaagcgaaaagacggacagac
tgtcaatatgctgttgcagccatcggaagcggcggcgggaacgggctggctttattattt
gaagttcttgcatag

DBGET integrated database retrieval system