KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_07635Help
Entry
I653_07635        CDS       T02520                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00020  Citrate cycle (TCA cycle)
bsy00620  Pyruvate metabolism
bsy01100  Metabolic pathways
bsy01120  Microbial metabolism in diverse environments
bsy01200  Carbon metabolism
bsy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I653_07635
   00620 Pyruvate metabolism
    I653_07635
Enzymes [BR:bsy01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     I653_07635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA CPSase_L_D2 Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 ATP-grasp Dala_Dala_lig_C ATP-grasp_3 HlyD_3 HlyD_D23 RimK GCV_H ATP-grasp_4 ATPgrasp_Ter RnfC_N YqfD
Motif
Other DBs
NCBI-ProteinID: AGI28783
Position
1512828..1516274
Genome map
AA seq 1148 aa AA seqDB search
MSQQSIQKVLVANRGEIAIRIFRACTELNIRTVAVYSKEDSGSYHRYKADEAYLVGEGKK
PIDAYLDIEGIIDIAKRNKVDAIHPGYGFLSENIHFARRCEEEGIVFIGPKSEHLDMFGD
KVKAREQAEKAGIPVIPGSDGPAETLEAVEQFGQANGYPIIIKASLGGGGRGMRIVRSES
EVKEAYERAKSEAKAAFGNDEVYVEKLIENPKHIEVQVIGDKQGNVVHLFERDCSVQRRH
QKVIEVAPSVSLSPELRDQICEAAVALAKNVNYINAGTVEFLVANNEFYFIEVNPRVQVE
HTITEMITGVDIVQTQILVAQGHSLHSKKVNIPEQKDIFTIGYAIQSRVTTEDPQNDFMP
DTGKIMAYRSGGGFGVRLDTGNSFQGAVITPYYDSLLVKLSTWALTFEQAAAKMVRNLQE
FRIRGIKTNIPFLENVAKHEKFLTGQYDTSFIDTTPELFNFPKQKDRGTKMLTYIGNVTV
NGFPGIGKKEKPAFDKPLSVKVDVDQQPARGTKQILDEKGAEGLASWVKEQKSVLLTDTT
FRDAHQSLLATRIRSHDLKKIANPTAALWPELFSMEMWGGATFDVAYRFLKEDPWKRLED
LRKEVPNTLFQMLLRSSNAVGYTNYPDNVIKEFVKQSAQSGIDVFRIFDSLNWVKGMTLA
IDAVRDTGKVAEAAICYTGDILDKNRTKYDLAYYTSMAKELEAAGAHILGIKDMAGLLKP
QAAYELVSALKETIDIPVHLHTHDTSGNGIYMYAKAVEAGVDIIDVAVSSMAGLTSQPSA
SGFYHAMEGNDRRPEMNVQGVELLSQYWESVRKYYSEFESGMKSPHTEIYEHEMPGGQYS
NLQQQAKGVGLGDRWNEVKEMYRRVNDMFGDIVKVTPSSKVVGDMALYMVQNNLTEKDVY
EKGESLDFPDSVVELFKGNIGQPHGGFPEKLQKLILKGQEPITVRPGELLEPVSFEAIKQ
EFKEQHNLEISDQDAVAYALYPKVFTDYVKTTESYGDISVLDTPTFFYGMTLGEEIEVEI
ERGKTLIVKLISIGEPQPDATRVVYFELNGQPREVVIKDESIKSSVKERLKADRTNPSHI
AASMPGTVIKVLAEAGTKVNKGDHLMINEAMKMETTVQAPFSGTIKQVHVKNGEPIQTGD
LLLEIEKA
NT seq 3447 nt NT seq  +upstreamnt  +downstreamnt
ttgtctcagcaatcgatacaaaaagtattagtagcaaacaggggagaaattgcaatccga
atattccgggcgtgtaccgagttgaatattcgtacagttgcggtctattcaaaagaagat
tccggttcctaccatcggtacaaagcggatgaagcatacttggtcggtgaagggaaaaaa
ccgattgatgcttacctggatattgaaggtatcattgatattgcgaaaagaaacaaagtc
gatgcaattcatccgggatacggtttcttatctgaaaatattcattttgcgagacgatgt
gaagaagaaggcatcgtattcatagggccaaaatccgagcatctcgatatgtttggtgac
aaggtaaaagcgcgtgagcaggcagaaaaagcgggaatccccgtgattccgggaagcgac
ggtcctgccgaaacacttgaagccgtcgaacaatttggacaagctaacggttatccgatc
atcattaaagcctcgcttggcggcggcggccgcggtatgcggattgtcagatctgaaagt
gaagtcaaagaagcatatgagcgtgctaaatcagaggcgaaagcagcctttggcaatgat
gaagtttatgtagaaaaattaattgagaatccaaaacatattgaggttcaggtcattgga
gacaagcagggcaatgtcgtccatctttttgagagggattgttccgttcaaagacgccat
caaaaggtcattgaagtggcgccgagtgtctcgctgtcacctgaattaagggatcaaatt
tgtgaggcggcagttgcgcttgccaaaaatgtaaactatataaatgcggggacggtcgaa
ttccttgttgcaaacaacgagttctactttattgaagtaaaccctcgcgtacaagttgaa
cacacgataacagaaatgattactggtgtcgatattgttcaaactcagatccttgttgcc
caagggcacagccttcacagcaaaaaagtaaatattcctgagcaaaaggacatttttaca
atcggctatgccattcagtcacgggttacgactgaagatccgcaaaatgatttcatgcct
gatacaggaaaaattatggcttaccgctcaggcggcggttttggtgtccgtcttgatacc
ggaaacagcttccagggcgccgtgatcacaccatactatgattcacttctcgttaagctt
tcaacttgggctttaacgtttgaacaggcagctgccaaaatggtacgaaaccttcaggag
tttagaatcagaggcataaaaacgaacattccgttccttgagaacgttgcaaaacatgag
aagttcctgacagggcaatatgatacgtctttcattgatacaacgcctgaattatttaat
ttccctaaacaaaaagaccgcggaacgaaaatgctcacttacatcggcaatgtgacagta
aacggcttccccggaatcgggaaaaaagaaaaaccggcgtttgacaaaccgttaagcgta
aaggtagacgttgatcagcagcctgccagaggaacaaagcaaattctcgatgaaaaaggt
gcagaagggcttgcaagttgggttaaggagcagaaatctgtccttttaactgatacgaca
ttcagggatgcccaccaatcgttattggcaactagaatcagatcgcatgatttgaaaaaa
atcgcaaatcctacggctgcgttatggcctgaactattcagtatggaaatgtggggaggc
gcgaccttcgatgtagcctaccgattcctgaaagaagatccgtggaagcgtttggaagat
cttcgcaaagaagtgccaaataccttattccagatgctgcttcgctcatcaaatgcggtc
ggctatacgaattatccggacaatgtgattaaagaatttgtgaagcaatcagctcaatcc
ggtattgatgtgtttcgtattttcgacagcttaaactgggtaaaagggatgacgttagcc
attgatgccgttcgggataccggaaaagtggcagaagctgcgatttgttatacgggagat
atccttgacaagaaccggacgaagtacgatcttgcttattatacatcgatggcgaaggag
cttgaggcggccggagcccatattctcgggattaaagatatggcagggctgttaaaaccg
caggctgcatatgaactcgtttctgcgttgaaagaaacgatcgacattccggttcacctt
catacgcatgatacgagcggaaacggtatttatatgtatgcgaaagctgttgaagccggc
gttgatatcatagacgtggcggtcagctcaatggcgggattaacgtcacagcctagcgcg
agcggattttatcatgcgatggaaggcaacgatcgccgtccggaaatgaatgtccaaggc
gttgaattgctgtcccaatattgggagtcggtgcgcaaatattatagtgaatttgaaagc
ggaatgaagtctccgcatactgaaatatatgagcacgagatgccagggggccaatatagc
aacctgcagcagcaagccaagggagtaggccttggggaccgctggaacgaagtcaaggaa
atgtacagacgcgtgaacgacatgttcggtgacatcgtcaaggtaacgccttcctcaaaa
gtagtcggagatatggcactctacatggtgcaaaacaatctgactgaaaaagacgtttac
gaaaaaggcgaatctttagatttccctgattctgtcgtggagcttttcaaaggaaatatc
ggccagcctcatggcggattcccggaaaaactgcaaaagcttatcttaaaagggcaggag
ccgattacagtcagaccgggcgaactgcttgagccggtgtcatttgaagcgatcaaacag
gaatttaaagagcagcataacttggaaatttcagatcaggatgctgtggcatatgccctt
tatcctaaagtcttcactgattatgtgaaaacgacagaaagctatggagacatttcggta
ttagatacaccgacattcttctacggtatgacattgggtgaagagatagaagttgaaatt
gagcgcggcaaaacgctgatcgttaagctgatttcaatcggtgagcctcagcctgacgcc
actcgcgtcgtttatttcgaactgaatgggcagccgcgcgaagtagttattaaagatgaa
agcattaagtcttccgttaaggaaaggctgaaagcagaccggacaaatccaagccacatc
gcagcttccatgcctggaaccgttattaaggtattggctgaagcaggcacaaaagtcaat
aaaggtgatcatttgatgattaatgaagcgatgaaaatggaaacaacggttcaggcgcct
ttctcaggaacaatcaagcaggttcatgtgaaaaatggcgagccgatccaaacgggagat
ctgcttctcgaaattgaaaaagcataa

DBGET integrated database retrieval system