KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_11595Help
Entry
I653_11595        CDS       T02520                                 

Definition
(GenBank) degradative acetoacetyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00071  Fatty acid degradation
bsy00072  Synthesis and degradation of ketone bodies
bsy00280  Valine, leucine and isoleucine degradation
bsy00310  Lysine degradation
bsy00362  Benzoate degradation
bsy00380  Tryptophan metabolism
bsy00620  Pyruvate metabolism
bsy00630  Glyoxylate and dicarboxylate metabolism
bsy00640  Propanoate metabolism
bsy00650  Butanoate metabolism
bsy00900  Terpenoid backbone biosynthesis
bsy01100  Metabolic pathways
bsy01110  Biosynthesis of secondary metabolites
bsy01120  Microbial metabolism in diverse environments
bsy01130  Biosynthesis of antibiotics
bsy01200  Carbon metabolism
bsy01212  Fatty acid metabolism
bsy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    I653_11595
   00630 Glyoxylate and dicarboxylate metabolism
    I653_11595
   00640 Propanoate metabolism
    I653_11595
   00650 Butanoate metabolism
    I653_11595
  Lipid metabolism
   00071 Fatty acid degradation
    I653_11595
   00072 Synthesis and degradation of ketone bodies
    I653_11595
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I653_11595
   00310 Lysine degradation
    I653_11595
   00380 Tryptophan metabolism
    I653_11595
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I653_11595
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I653_11595
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    I653_11595
Enzymes [BR:bsy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I653_11595
Exosome [BR:bsy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I653_11595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGI29568
Structure
PDB: 

Position
complement(2328874..2330055)
Genome map
AA seq 393 aa AA seqDB search
MRKTVIVSAARTPFGKFGGVLKEVKAAELGGIVMKEALQRAGVSGDDVEGNVMGMVVQAG
SGQIPSRQAARLAGMPWSVPSETLNKVCASGLRAVTLCDQMIRAQDADILVAGGMESMSN
IPYAVPAGRWGARMGDGELRDLMVYDGLTCAFDEVHMAIHGNTAAKDYAISRREQDEWAL
RSHARAAKAADEGKFQDEIVPVNWIGRKGKPNVVHKDEAIRRDTSLDQLAKLAPIYASDG
SITAGNAPGVNDGAGAFVLMSEEKAAELDKRPLATILGFSTVGMPAHELAAAPGFAINKL
LKKNGLTVQDIDLFEVNEAFASVVLTCEKIVGFDLEKVNVNGGAIALGHPIGASGARILM
TLVYELKRRGGGLGVAAICSGAAQGDAVLVQVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaacagtcattgtaagtgctgcaagaacgccatttggcaaattcggcggagta
ttgaaagaggtgaaagctgctgagcttgggggcattgtgatgaaggaggcgctgcaacgg
gctggagtctctggagatgatgtagaaggaaacgttatgggcatggttgtccaggccggc
tcagggcagataccttcccgtcaagctgcccgtctggcgggaatgccttggagtgtgccg
tcagaaacactgaataaagtctgcgcttccggccttcgcgctgtcactttatgtgatcaa
atgattcgggcgcaggatgcggacatacttgttgccgggggaatggaaagcatgagcaat
atcccgtatgccgttcccgccgggcgctggggagcacggatgggggacggcgagcttagg
gacttaatggtgtatgacggattaacgtgcgcgtttgacgaggtgcacatggctattcac
ggaaatacagcggccaaggattatgcaatctcacgaagagagcaggacgaatgggcgttg
agaagtcacgcaagggcagctaaggcagccgatgaagggaagtttcaggatgaaattgtt
cccgtcaactggatcggtcgaaaaggaaaaccaaacgttgttcataaagatgaagcgatt
cgccgtgacacaagtctggatcagctcgcgaaacttgctccgatttatgcaagtgacggt
tctatcacagccggcaatgctcctggggtcaatgacggagccggcgcgtttgtgctgatg
tctgaggaaaaagctgctgagcttgacaaacggcctctggctacaattcttggtttttca
actgtgggaatgccagcgcacgagctggcggcagcgccggggtttgcaattaacaagctc
ctgaaaaagaacggtttaactgtccaagatattgacttgtttgaagtaaatgaagctttt
gcttcagttgttttgacatgtgaaaaaatcgtaggtttcgatcttgaaaaagtaaatgta
aatggcggtgcgatcgcgctcggccacccgatcggcgcgagcggggcaagaattctcatg
acgcttgtttatgaattaaagcgacggggagggggtctgggcgttgccgctatttgcagc
ggggcagcacagggagacgccgtcttagtgcaggttcattaa

DBGET integrated database retrieval system