KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_19590Help
Entry
I653_19590        CDS       T02520                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00010  Glycolysis / Gluconeogenesis
bsy00053  Ascorbate and aldarate metabolism
bsy00071  Fatty acid degradation
bsy00280  Valine, leucine and isoleucine degradation
bsy00310  Lysine degradation
bsy00330  Arginine and proline metabolism
bsy00340  Histidine metabolism
bsy00380  Tryptophan metabolism
bsy00410  beta-Alanine metabolism
bsy00561  Glycerolipid metabolism
bsy00620  Pyruvate metabolism
bsy00625  Chloroalkane and chloroalkene degradation
bsy01100  Metabolic pathways
bsy01110  Biosynthesis of secondary metabolites
bsy01120  Microbial metabolism in diverse environments
bsy01130  Biosynthesis of antibiotics
Module
bsy_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I653_19590
   00053 Ascorbate and aldarate metabolism
    I653_19590
   00620 Pyruvate metabolism
    I653_19590
  Lipid metabolism
   00071 Fatty acid degradation
    I653_19590
   00561 Glycerolipid metabolism
    I653_19590
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I653_19590
   00310 Lysine degradation
    I653_19590
   00330 Arginine and proline metabolism
    I653_19590
   00340 Histidine metabolism
    I653_19590
   00380 Tryptophan metabolism
    I653_19590
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    I653_19590
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    I653_19590
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    I653_19590
Enzymes [BR:bsy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     I653_19590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC HXXSHH
Motif
Other DBs
NCBI-ProteinID: AGI31150
Position
3903666..3905003
Genome map
AA seq 445 aa AA seqDB search
MEQQVKDDIQRVFQLQKKQQKALRASTAEQRREKLQRFLDSVIAHEEEIIEAIRKDVRKP
YHEVKKAEIEGTKKAIRDNMNNLEQWMAPKEVGSSLSPDANGILMYEPKGVTLILGPWNY
PFMLTMAPLAASLAAGNSAIVKLSDFTMNTSNIAAKVIRDAFDDKEVAIFEGEVEVATEL
LDQPFDHIFFTGSTNVGKIVMTAAAKHLASVTLELGGKSPTIIDSDYDLMDAAKKIAVGK
FVNAGQTCIAPDYLFIKKDVQDRFAGILQTIVNAGFMEDDHTPDRSKFTQIVNDRNFNRV
KDLFDDAIKKGAEVVFGGVFDASDRTISPTVLKNVTPDMKIMQEEIFAPILPMMNYEDID
EVIDYVNDHDKPLALYVFSQNQDLIDNVLQHTTSGNAAINDVVVHFSDVNLPFGGVNTSG
IGSYHGVYGFKEFSHEKGVFIQASK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggaacagcaagtaaaggacgacatccagcgtgtctttcagcttcagaaaaaacagcaa
aaagccttgcgcgcttcaacagcggaacagcggagagaaaagcttcaacgctttttagat
tccgtcatcgcccatgaagaagaaatcatcgaagcgatccgcaaagacgtccgcaaacca
tatcacgaggtcaaaaaagcggaaatcgaaggaacaaaaaaagcgatcagagataatatg
aataacctggaacaatggatggcgcctaaagaagtcggttcatcgttaagccctgacgca
aacggaattcttatgtacgagcctaaaggcgtcacactcatcctcggcccgtggaactat
ccgtttatgctgacgatggcgccgcttgccgcttctctcgcagccggaaacagcgcgatt
gtgaagctgtccgatttcacgatgaacacgagcaacattgccgctaaagtgataagagac
gcttttgatgacaaagaagtcgcgatttttgaaggagaggttgaggtggcaaccgagctt
cttgatcagccgttcgaccacattttcttcactggaagcacaaatgtcgggaaaatcgtc
atgacagcggctgccaaacacttggcatctgtcacacttgagcttggcggcaagagccca
acgattatcgacagcgattacgatctgatggacgcagcgaaaaagatcgccgtcgggaaa
ttcgtaaacgctggccaaacctgcatcgcacctgattacctgttcattaaaaaagacgtt
caggacaggttcgcggggattttacaaacaatcgttaacgcaggatttatggaggatgat
cataccccagaccgcagcaaatttacgcagatcgtcaatgaccgcaacttcaaccgcgtc
aaagatctgttcgacgatgccatcaaaaaaggggcggaagtggtgttcggcggcgtattt
gatgccagcgaccgcacgatctcgccaaccgttttgaaaaacgtcacgcctgatatgaaa
atcatgcaggaggaaatcttcgcaccaatcctgccgatgatgaattatgaagacatcgac
gaggtcatcgattacgtaaatgatcacgataaaccgcttgcgctttatgtattcagccaa
aaccaagacctgattgacaacgtccttcagcacacgacatcaggaaatgccgccatcaat
gatgtcgtcgtccatttcagtgacgtcaacctgccattcggcggcgtcaacacaagcgga
atcggctcctatcatggggtatacggattcaaagagttttctcatgagaagggtgtcttt
attcaggcctctaaataa

DBGET integrated database retrieval system