KEGG   Brucella suis bv. 3: DK67_1756Help
Entry
DK67_1756         CDS       T03266                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bsz  Brucella suis bv. 3
Pathway
bsz00010  Glycolysis / Gluconeogenesis
bsz00071  Fatty acid degradation
bsz00350  Tyrosine metabolism
bsz00625  Chloroalkane and chloroalkene degradation
bsz00626  Naphthalene degradation
bsz01100  Metabolic pathways
bsz01110  Biosynthesis of secondary metabolites
bsz01120  Microbial metabolism in diverse environments
bsz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DK67_1756
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DK67_1756
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DK67_1756
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DK67_1756
   00626 Naphthalene degradation
    DK67_1756
Enzymes [BR:bsz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DK67_1756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 PALP adh_short TrkA_N MAF_flag10 NADH_4Fe-4S Limkain-b1 CMAS
Motif
Other DBs
NCBI-ProteinID: AIJ71364
Position
1:complement(1822790..1823818)
Genome map
AA seq 342 aa AA seqDB search
MRALQLLDDRRLEITDIAPPPLPGMGEVTVRIKAVALNHIDVWGWRGMAFAKRKMPLVIG
AEASGVVDAVGPGVSNLLPGQLVSIYGARTCGLCRACREGRDNLCEHVGGVHGFHLDGFA
CEAVNLPARLLVAAPPGVDAIGAAVAPVTFGTVEHMLFDNAKLEPGETVLVQAGGSGIGT
AAIQLAKKMGCTVITTVGSNDKIEKAKALGADHVINYREDRFEGVVRKLTKKKGVDVVFE
HVGADTWAGSMLCMKRGARLVTCGSTSGVSTNMNLMQLFQQQLKIFGSFGCRMENMADAM
QKMARGIVHPVIDTVVGFSDIDTALKRMEGRDVFGKIILQID
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccttgcagcttctcgatgatcgccgccttgaaatcaccgatattgcgcccccg
ccgctgcccggcatgggggaagtgaccgttcgcatcaaggccgtggcgctcaaccatatc
gatgtctggggctggcgcggcatggcctttgccaagcgcaagatgccgctcgtcatcggt
gcagaggcttccggtgttgtcgatgctgtcggtcccggcgtttccaatctcctgcccggc
cagctcgtttccatctatggcgcgcgcacctgcgggctttgccgcgcctgccgcgaaggc
cgtgacaatctttgcgaacatgtgggcggcgtgcatggtttccatcttgatggctttgcc
tgcgaagcggtgaaccttcccgcccgcctgctggttgccgcacctcccggcgtggatgct
atcggcgcggctgttgctccggtcacattcggcacggtggaacatatgctgttcgacaat
gccaagcttgaacccggcgaaaccgtgctcgttcaggctggcggctcaggcattggcacg
gctgcgatccagcttgcaaagaagatgggctgcacagtcatcaccacagtcggctccaac
gacaagatcgagaaggccaaggctcttggcgccgatcacgtcatcaattaccgcgaggac
cgtttcgagggcgtggtgcgcaagctcaccaagaagaagggcgtggatgtggtgttcgag
catgtgggcgcggacacatgggcaggctccatgctgtgcatgaagcgcggcgcgcgtctc
gtcacctgcggctcgacctcgggcgtttccacgaacatgaacctgatgcagcttttccag
cagcagttgaagattttcggctccttcggctgccgcatggaaaacatggccgacgccatg
cagaagatggcacgcggcatcgtgcatccggtcatcgacaccgtggttggctttagcgat
atcgacacggcgctgaagcgcatggaaggccgcgacgtcttcggcaagatcattctccag
atcgactga

DBGET integrated database retrieval system