KEGG   Brucella suis bv. 3: DK67_2085Help
Entry
DK67_2085         CDS       T03266                                 

Gene name
psald
Definition
(GenBank) phenylserine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bsz  Brucella suis bv. 3
Pathway
bsz00260  Glycine, serine and threonine metabolism
bsz01100  Metabolic pathways
bsz01110  Biosynthesis of secondary metabolites
bsz01120  Microbial metabolism in diverse environments
bsz01130  Biosynthesis of antibiotics
bsz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DK67_2085 (psald)
Enzymes [BR:bsz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DK67_2085 (psald)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIJ69432
Position
2:complement(41571..42620)
Genome map
AA seq 349 aa AA seqDB search
MHFASDNWAGAHPKIAESLSLHAAGFAAAYGASEIDKRVEQHFNELFEREVAVFFVGTGT
AANSLALASVNRPGGVSLVHREAHVIEDECGAPEYFTGGARLHPIDGALGRIDPELLKRE
LKRFNPAFVHAGQPMAVSITQATEVGTLYQPEHIATISQICRDAGLPLHMDGARFANALV
SLDLTPAEMTWKLGVDIVSFGGTKNGCWCAEALVFMDPARAKDLPFIRKRAAQLFSKTRF
VAAQFDAYLRDDLWRDLARHSNALAARLANHIHASSQMRLAWKPEANEVFAIMKQSVYDR
LRDAGAVFYDWNPPHSEVGRIGEGEIFARFVTGFANTEEEVDRFGDMIA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgcattttgcgtcagacaattgggcaggcgcccatccaaaaatcgccgagagcctttcg
ctgcatgcagccggttttgcggcagcctatggcgcaagcgagatcgacaaacgtgtggaa
caacacttcaacgaattgttcgagcgtgaagtggccgttttctttgtcggaaccggtacg
gctgccaattcgctggcgctggccagcgtcaaccggcccggcggcgtttcgctggtccac
cgcgaggcgcatgtgatcgaggatgaatgcggcgcaccggaatatttcaccggcggcgca
cgtctccacccgatcgacggcgcgctgggccgcattgatcccgaacttctgaaacgcgaa
ttgaagcgtttcaaccccgccttcgttcacgcgggccagcccatggccgtcagcatcacg
caggcgacggaagtgggtacgctttaccagccggagcatatcgccaccatttcgcaaatc
tgccgcgatgccggactgccgctacacatggatggcgcacgctttgccaatgcgctcgtg
tcgcttgatctcacacctgccgaaatgacatggaaacttggcgtggacattgtgtccttc
ggcggcaccaagaatggctgctggtgcgccgaggcgctggtcttcatggacccggcccgc
gccaaagacctgcccttcatccgcaagcgcgcagcacagcttttctccaagacgcgcttc
gttgccgcgcagttcgatgcctatctgcgtgacgatctctggcgcgaccttgcccgccat
tccaacgcgcttgctgcccgccttgccaaccatatccatgcatcaagccagatgcgcctt
gcctggaaaccggaagccaacgaggttttcgcgatcatgaagcaatcggtttatgaccgt
ctgcgcgatgcgggtgcggtattctacgactggaatcctccgcattcggaagtgggccgc
atcggcgagggcgagatttttgcccgctttgtcaccggcttcgccaatacggaagaagaa
gtggaccgtttcggcgacatgatcgcctga

DBGET integrated database retrieval system