KEGG   Brucella suis bv. 3: DK67_2308Help
Entry
DK67_2308         CDS       T03266                                 

Definition
(GenBank) polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylase family protein
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
bsz  Brucella suis bv. 3
Pathway
bsz00130  Ubiquinone and other terpenoid-quinone biosynthesis
bsz00627  Aminobenzoate degradation
bsz01100  Metabolic pathways
bsz01110  Biosynthesis of secondary metabolites
bsz01120  Microbial metabolism in diverse environments
bsz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    DK67_2308
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    DK67_2308
Enzymes [BR:bsz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     DK67_2308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AIJ69150
Position
2:271036..271626
Genome map
AA seq 196 aa AA seqDB search
MKRIVIGVSGASGSLIPLKLLERLAVMEEVETHLVISDAAQQTLRYELGANGYSLLYRLA
ARTYAVEDVGAAIASGSVPTAGMIIAPCSMRTLSAIANGYSDSLLTRAADVHLKERRKLM
LIARETPLHLVHLRNMCTVTEMGAIVMPPVPAFYLQPQTVEDVASQVAARAIDLIGVGTP
QAQSWNPEEKPRRKAG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggatcgtcatcggtgtttcgggtgcttcgggctccctcattcctctcaagctt
cttgagcggctcgcggtgatggaggaggtggaaacccaccttgtcatttccgatgccgcg
cagcagaccttgcgctacgagcttggagcgaacggctattccttgctgtaccggctggcc
gcgcgcacctatgcggtggaggatgtgggggcggcgattgccagcggctcggtgccgacg
gcggggatgattattgcgccctgttccatgcgcacactttcagccattgccaatggctat
agcgacagcctgttgacgcgggctgcggatgtgcacctcaaagagcgccgcaagctcatg
ctgatcgcgcgcgaaacgccgcttcatctggttcacctgcgcaatatgtgcacggtcacg
gaaatgggcgcaatcgtcatgccgcccgtgcctgccttctatcttcagccgcagacggtg
gaggatgtagcgagccaggtcgccgcgcgcgccattgatctcattggcgtcggcacaccg
caggcgcaaagctggaacccggaagaaaaaccccgccggaaggcggggtga

DBGET integrated database retrieval system