KEGG   Brucella suis bv. 3: DK67_572Help
Entry
DK67_572          CDS       T03266                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsz  Brucella suis bv. 3
Pathway
bsz00071  Fatty acid degradation
bsz00072  Synthesis and degradation of ketone bodies
bsz00280  Valine, leucine and isoleucine degradation
bsz00310  Lysine degradation
bsz00362  Benzoate degradation
bsz00380  Tryptophan metabolism
bsz00620  Pyruvate metabolism
bsz00630  Glyoxylate and dicarboxylate metabolism
bsz00640  Propanoate metabolism
bsz00650  Butanoate metabolism
bsz00900  Terpenoid backbone biosynthesis
bsz01100  Metabolic pathways
bsz01110  Biosynthesis of secondary metabolites
bsz01120  Microbial metabolism in diverse environments
bsz01130  Biosynthesis of antibiotics
bsz01200  Carbon metabolism
bsz01212  Fatty acid metabolism
bsz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DK67_572 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    DK67_572 (phbA)
   00640 Propanoate metabolism
    DK67_572 (phbA)
   00650 Butanoate metabolism
    DK67_572 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DK67_572 (phbA)
   00072 Synthesis and degradation of ketone bodies
    DK67_572 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DK67_572 (phbA)
   00310 Lysine degradation
    DK67_572 (phbA)
   00380 Tryptophan metabolism
    DK67_572 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DK67_572 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DK67_572 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK67_572 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsz04147]
    DK67_572 (phbA)
Enzymes [BR:bsz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DK67_572 (phbA)
Exosome [BR:bsz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DK67_572 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIJ71081
Position
1:616941..618125
Genome map
AA seq 394 aa AA seqDB search
MSDPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVL
TAGEGQNPARQAAMGAGCPKETTAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQES
MSMAPHCAYLRSGVKMGDFKMIDTTLKDGLTDAFHGYHMGITAENIARQWQLSRSEQDEF
ALASQHKAEAAQKAGRFDEEIVPFTVKARKGDVVVSADEYIRPGTTMEVLAKLKPAFDKE
GTVTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVHPSIMGTGPIPATRK
ALEKAGWSVGDLDLVEANEAFAAQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVL
TTLLYEMERRDAKRGLATLCIGGGMGVALCVERD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatccgaaatccatcgtcatcgccagtgcagcgcgcaccgcggtgggtgccttt
aatggcgcctttgccaatgttcctgctcatgaactgggtgcagtggccatcaaggctgct
ctggagcgtgctggtgtcgatgcggcggatgtcgatgaggttattctggggcaggtgctg
acggcaggcgaagggcagaatcccgcccgtcaggccgccatgggggccggttgcccgaag
gaaaccaccgcttttgccatcaaccagctctgcggttccggcctgcgggcggttgcgctc
gggatgcagcagattgtttccggcgatgcgaagattatcgtggcgggcgggcaggaatcc
atgtccatggcgccgcattgtgcctatctgcgctccggcgtgaagatgggcgatttcaag
atgatcgacaccacgctgaaagacggcctgaccgatgctttccatggctatcacatgggc
atcaccgctgaaaatattgcgcgccaatggcagttgagccgcagcgagcaggacgagttc
gcactcgcctcgcagcacaaagccgaggccgcgcagaaggcaggccgcttcgatgaggag
atcgtgcctttcaccgtcaaggcccgcaagggggatgttgtggtttcggcagatgaatat
atccgtccgggcacgacgatggaggtgctggccaagctgaagccggcttttgacaaggaa
ggcacggtgacggcgggcaatgcatccggcatcaatgacggtgccgcagcggttgtgctg
atggatgctggcgaggcagccaggcgtggcgtgaagcctctggcgcgcatcgtatcctgg
gcgacggctggcgttcatccgtcgatcatgggaaccgggccgattcccgcaacgcggaag
gcgctggaaaaggcaggctggagcgttggcgaccttgatcttgttgaggccaatgaggcc
tttgcagcgcagtcatgcgcggtggtgcgcgatctgggtctcaatcctgaaatcgtcaat
gtcaatggcggcgcaatcgccatcggccatccgatcggcgcctccggcgcccgcgtgctg
acgacgctgctctacgaaatggagcgtcgcgatgccaagcgtggtctggcgacgctttgt
atcggcggcggcatgggcgtggccctttgtgtcgagcgggattga

DBGET integrated database retrieval system