KEGG   Brucella suis bv. 3: DK67_850Help
Entry
DK67_850          CDS       T03266                                 

Definition
(GenBank) hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
bsz  Brucella suis bv. 3
Pathway
bsz00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DK67_850
Enzymes [BR:bsz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     DK67_850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2
Motif
Other DBs
NCBI-ProteinID: AIJ72123
Position
1:900823..901509
Genome map
AA seq 228 aa AA seqDB search
MKRSEINEIIRESDAFIRSFGYIMPPFAYWSPEELKQRTAGDVAAIRKARLGWDITDYGQ
GKFADLGLFLFTVRNGNAEDLKRGTGMLYAEKIMISRKNQLSPMHRHVVKAEDIINRGGG
TLVLELFNSRPDGSVDEETDVTVATDGRLVTQKAGAHLKLQPGESVTLLPGNWHAFWGEG
GDVLIGEVSTVNNDLTDNIFREPIGRFSDIEENEQPLHLLVSDYDKWL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctctgaaatcaatgaaatcatccgtgaaagcgatgcctttatccgctcgttc
ggttatatcatgccgccctttgcctattggtcgccggaagagctgaagcagcgcacggct
ggcgatgtggcggcgatccgcaaggcgcggcttggctgggatattaccgattacgggcag
ggcaagtttgccgatctcggcctgtttcttttcacggttcgcaatggcaatgccgaggac
ctgaagcgtggtacaggcatgctctatgccgaaaagatcatgatttcgcgtaaaaatcag
ctttcccccatgcatcgccatgtggtgaaggcggaagatatcatcaatcgcggtggcggg
acgctggtgctggaattgttcaattcgcggcctgatggcagcgtggacgaggaaaccgac
gtgactgtggcgaccgatgggcggcttgttacccagaaggcgggcgcgcatctgaagctc
cagcccggcgagagcgtaacgctcctgcccggcaattggcacgctttctggggtgagggc
ggcgatgtgctgatcggtgaggtttcgactgtcaataacgatctgaccgacaatatcttc
cgcgagccgattggccgcttctcggatatcgaggaaaacgagcagcccttgcatctgctt
gtgtctgattacgacaagtggctatag

DBGET integrated database retrieval system