KEGG   Bos taurus (cow): 100126171Help
Entry
100126171         CDS       T01008                                 

Gene name
DPYSL5
Definition
(RefSeq) dihydropyrimidinase-related protein 5
  KO
K07529  dihydropyrimidinase-like 5
Organism
bta  Bos taurus (cow)
Pathway
bta04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100126171 (DPYSL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 100126171
NCBI-ProteinID: NP_001103434
BGD-bta: BT16703
Ensembl: ENSBTAG00000018576
VGNC: 28198
UniProt: A8E641
Position
11
AA seq 564 aa AA seqDB search
MLANSASVRILIKGGKVVNDDCTHEADVYIENGIIQQVGRELMIPGGAKVIDATGKLVIP
GGIDTSTHFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDKETSLVEAYEKCRGLA
DPKVCCDYALHVGITWWAPKVKVEMETLVREKGVNSFQMFMTYKDLYMLRDSELYQVFHA
CKDIGAIARVHAENGELVAEGAKEALDLGITGPEGIEISRPEELEAEATHRVITIANRTH
CPIYLVNVSSISAGDVIAAAKMQGKVVLAETTTAHATLTGLHYYHQDWSHAAAYVTVPPL
RLDTNTSTYLMSLLANDTLNIVASDHRPFTTKQKAMGKEDFTKIPHGVTGVQDRMSVIWE
RGVVGGKMDENRFVAVTSSNAAKILNLYPRKGRIIPGADADVVVWDPEATKTISASTQVQ
GGDFNLYENMRCHGVPLVTISRGRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREK
TLKVRGVDRTPYLGDVAVIVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQI
DDHVPKRASARILAPPGGRSSGIW
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccaattcagccagcgtgcggattctcatcaagggaggcaaggttgtgaacgat
gactgcacccacgaggctgatgtctacatcgagaatggcatcatccagcaagtgggccgt
gaactcatgatccctggaggggccaaagtgattgatgccacggggaagctggtgatccct
ggaggcatcgacaccagcacccacttccaccagaccttcatgaatgccacgtgcgtggac
gacttctaccatgggaccaaggcagcactcgttggaggcaccaccatgatcatcggccat
gtcctgcctgacaaggagacctcccttgtggaagcctacgagaagtgccggggtctggcc
gaccccaaggtttgctgtgactatgccctccacgtggggatcacctggtgggctcccaag
gtgaaagtggaaatggagaccctggtgagggagaagggagtcaactcgtttcagatgttc
atgacctacaaggacttgtatatgcttcgggacagcgagctgtaccaagtgtttcacgct
tgcaaggatattggagctatcgcccgagtccatgctgaaaatggggagctcgtggctgag
ggagcaaaggaagcactagacttgggtatcacaggcccagaaggcattgagatcagccgt
ccagaggagctggaagcagaagccactcaccgagttatcaccattgcaaacagaactcac
tgtcccatctatctggtcaacgtgtccagcatctcagccggtgatgttattgcagctgct
aagatgcaagggaaggttgtgctggctgagaccaccactgcacacgccacgctcacgggc
ttacactactaccaccaggactggtcccacgcagccgcctacgtcacggtgcctcccctg
agactggacaccaacacatcaacctacctcatgagcctgctggccaatgatactttgaac
attgtggcgtcagatcaccggcctttcaccacgaagcagaaagctatgggcaaggaggac
ttcactaagatcccccacggtgtgaccggggttcaggaccgcatgagcgtcatctgggag
agaggcgtggttggaggaaagatggatgagaaccgttttgtggccgttaccagttccaac
gcagccaagattctcaacctgtatccccgaaagggccgcatcatccctggagctgatgcc
gatgtggtggtgtgggaccccgaagccaccaagaccatctccgccagcacccaggtgcag
ggaggagacttcaacctgtacgagaacatgcgttgccatggcgtcccactggtcaccatc
agccgaggccgggtcgtgtacgagaacggcgtcttcatgtgtgctgaaggcaccggcaag
ttctgtcccctgcgatccttcccagacactgtctacaagaaactggtccagagagaaaag
accttaaaggtgaggggagtggaccgcacgccctacctgggggatgtagctgtcattgtg
catcctgggaaaaaagagatgggaacgccactggcagacactccaacccggcctgtcacc
cgacatgggggcatgagggaccttcatgaatccagtttcagcctttctggttctcagatc
gatgaccatgttccaaagcgagcctcggctcggatcctcgctccccccggaggcaggtca
agcggcatttggtaa

DBGET integrated database retrieval system