KEGG   Bos taurus (cow): 100138908Help
Entry
100138908         CDS       T01008                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B4 isoform X1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bta  Bos taurus (cow)
Pathway
bta00040  Pentose and glucuronate interconversions
bta00053  Ascorbate and aldarate metabolism
bta00140  Steroid hormone biosynthesis
bta00830  Retinol metabolism
bta00860  Porphyrin and chlorophyll metabolism
bta00980  Metabolism of xenobiotics by cytochrome P450
bta00982  Drug metabolism - cytochrome P450
bta00983  Drug metabolism - other enzymes
bta01100  Metabolic pathways
bta05204  Chemical carcinogenesis
Module
bta_M00014  Glucuronate pathway (uronate pathway)
bta_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100138908
   00053 Ascorbate and aldarate metabolism
    100138908
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100138908
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100138908
   00860 Porphyrin and chlorophyll metabolism
    100138908
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100138908
   00982 Drug metabolism - cytochrome P450
    100138908
   00983 Drug metabolism - other enzymes
    100138908
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100138908
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100138908
Glycosyltransferases [BR:bta01003]
 Others
  Hydrophobic molecule
   100138908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 100138908
NCBI-ProteinID: XP_002688373
BGD-bta: BT20765
Position
6
AA seq 532 aa AA seqDB search
MSKMSMKRLSLLLLLQLTCYFSGGSCGKVLVWPVEFSHWLNIKTILEELVTRGHEVTVLI
SSASTIPNSSKPSTMKFETFPVSLTKTDYENFIERLLEEWTYVSKDSFWSYLSTVRTLFW
EFFDTTLSICKDAVSNKKLMTKLQESRFDILIADAVGPCGELLAELLKIPFVYSHYTSPG
HIIEKNSGRLPLPPSYVPVMLSELSDRMTFMERIKNMFYTLYFELFFPTYKEKKWNQFYS
EVLGRPTTLSETMGKADVWLIRSYWDFSFPRPQLPNVEFVGGLHCKPAKPLPKEMEEFVQ
SSGENGIVVFSLGSMVSNMSEDRAKVIASAFAQIPQKVLWRYDGKKPDTLGPNTRLYKWL
PQNDLLGHPKTKAFITHGGSNGVYEAIYHGIPMVGTPLFADQADNIARMKSKGTAVRLDL
ETMSTRDLLNALKEVINNPSYKENVMRLSAIQHDQPMKPLDRAVFWIEFVMRHKGAKHLR
PAIHDLTWFQYHSLDVIGFLLACVATAIFVITKCCLFCCLKFAKLGKKEKRD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatgtctatgaaaaggctctcgcttctgctgctgctacagctgacttgctac
tttagcggtgggagttgtggaaaggtgctggtatggccagtggaatttagtcactggctg
aatataaagacaattctggaggaacttgtcacaaggggtcatgaggtgactgttctgata
tcttcagcttccactattcctaattccagcaaaccatctactatgaaatttgagactttt
cctgtatctttaacaaaaactgattatgagaattttatagaacgtcttcttgaggaatgg
acgtatgtgtcgaaagattccttttggtcctatctttcaacagtgagaactttattttgg
gaattttttgatactactttaagtatatgtaaagacgctgtttccaacaagaaattaatg
acaaaactgcaggaatcaaggtttgatatccttattgcagatgctgttggaccctgtggt
gaactgctggctgaattacttaaaataccattcgtgtacagtcattacacctcacctggc
cacataattgagaagaatagcggaagacttccactcccaccatcttatgtacctgttatg
ctttcagaattaagtgatcgcatgacattcatggagaggatcaaaaatatgttttataca
ctttattttgagcttttcttcccaacgtacaaagagaagaagtggaatcagttttacagt
gaagtactaggaagacctactaccttatcagagacaatggggaaagctgatgtgtggctc
attcgaagctactgggatttttcatttcctcgtccacaactaccaaatgttgaatttgtt
ggagggctccactgcaaacctgccaagcccctgcctaaggaaatggaagagtttgtgcag
agctctggagaaaatggtattgtggtgttttctttggggtcaatggtcagtaacatgtca
gaagacagagccaaggtgattgcatcagccttcgctcaaattccacaaaaggtgctatgg
agatatgatggcaaaaaaccagataccttaggacccaacacccggttgtataaatggctt
ccccagaatgaccttcttggccatccaaaaaccaaagcctttataactcacggtggaagc
aatggtgtttatgaggccatctatcacgggatccctatggtgggcactcctttgtttgct
gatcaagctgataacatcgctcgaatgaaatccaagggaacagctgtcaggttggacttg
gaaacaatgtcaacaagagatttgctcaacgcattgaaggaagtcattaataatccttcc
tacaaagagaatgtgatgagattatcagccattcaacatgatcagcctatgaagcccttg
gacagagcagtcttctggatcgagtttgtcatgcgccacaaaggagccaagcacttgcgg
ccagctatccatgacctcacctggttccagtaccactctctggatgtcattgggttccta
ctggcctgtgtggcaactgccatatttgtcatcacaaaatgttgtctattttgttgcttg
aagtttgctaaattaggaaagaaggagaaaagagactag

DBGET integrated database retrieval system