KEGG   Bos taurus (cow): 100294795
Entry
100294795         CDS       T01008                                 

Gene name
TULP4
Definition
(RefSeq) tubby-related protein 4 isoform X1
Organism
bta  Bos taurus (cow)
SSDB
Motif
Pfam: Tub ANAPC4_WD40 SOCS_box
Other DBs
NCBI-GeneID: 100294795
NCBI-ProteinID: XP_024852883
Ensembl: ENSBTAG00000005083
VGNC: 36522
Position
9
AA seq 1609 aa
MYAAVEHGPVLCSDSNILCLSWKGRVPKSEKEKPVCRRRYYEEGWLATGNGRGVVGVTFT
SSHCRRDRNTPQRINFNLRGHNSEVQEDPSQSTALTEEVSAYFVLAVHSVIHGFLAAGQM
VVLVRWNEPYQKLATCDADGGIFVWIQYEGRWSVELVNDRGAQVSDFTWSHDGTQALISY
RDGFVLVGSVSGQRHWSSEINLESQITCGIWTPDDQQVLFGTADGQVIVMDCHGRMLAHV
LLHESDGILSMSWNYPAFLVEDSSESDTDSDDYSPPQDGPAAYPIPVQNIKPLLTVSFTS
GDISLMNSYDDLSPTIIQSGLKEVVAQWCTQGDLLAVAGMERPSQFSDLPNGPLLKSAMV
KFYNVRGEHIFTLDTLVQRPIVSICWGHRDSRLLMASGPALYVVRVEHRVSSLQLLCQQA
IASALREDKDVNKLTLPPRLCSYLSTAFIPTIKSAPRVRVQGRLVLGDGTDPLVAQPPIP
DPNNMRDFVSYPSAGSERLHCTMKRTEDDPEVGGPCYTLYLEHLGGLVPILKGRRVSKLR
PEFVIMDPRTDSRADEIYGNSLISTMIDSCNCSDSSDIELSDDWAAKKSPKISRASKSPK
LPRINIEARKSPKLSRAAQELSRSPRLPMRKPSIGSPSLARREFPFEDITQHNYLAQVTS
NIWGTKFKIVGLAAFLPTNLGAVIYKTSLLHLQPRQMTIYLPEVRKISMDYVNLPVFNPN
VFSEDEDDLPVTGASGVPENNPPCTVNIPIAPIHSSAQAMSPTQSIGLVQSLLANQNVQL
DVLTNQTTAVGGAEHASESAAQYPVSSQYPVSSRYSNPGQVIFGGVEMGRGLPNPPQLSL
PPPAQGTIQLSVLDLGDRDHEHLQKPAKALRPVPQLATEGDAVVFSAPQEVQVAKMNPPP
PYPGTIPAAPTTAAPPPPLPPPQPPVDTCLKKGDFSLYPTAAHYQPPLGYERITTFDSSG
NVEEVCRPRTRMLCSQNTYTLPGPGSSATLRLTATEKKVPQPCTSATLNRLTVPRYSIPP
GDPPPYPDLSGQLGPSRGAGQRPDGGLIHATLRRNNREAALRAAQLAELPRPPPHPPKPK
GTAPFPARPPPALYTCSQCSGAGGAAGRPDPGAQPGASLAHAASTSPLTSQSSYNLLGAA
EGARERADYVNSAFTEDEALAQHCPADKPPRHPALGEAAVAVKRPPPYQWDPVLGEDVWV
PQERTAQSTVPNPLKLPPLVVGPGQHLDVSRVPFVSPKVPASPAATFQPGYGMGVPYSAG
CSTSPLPGVQAPCSPKDALAAAQFAQQESTVVLQPAYPPSLAYCTLPPMYPGSSACSSLQ
LPPIALHPWNSYSPCPPVQNPQGTLPPKAHLVVEKPLVSPPPTDLQSHLGTEVMVETADN
FQEVLSLTESPIPQRTEKFGKKNRKRLDSRAEEGNVQAITEGKVKKEARTLSDFNSLISS
PRLGREKKKVKSQKDQLKSKKLNKTNEFQDSSESEPELFISGDELMNQSQGSKKGWKSKR
SLRAASELEEFKCRKASEKEDGRLGSQGFVYVMANKQPLWNEATQVYQLDFGGRVTQESA
KNFQIELEGRQVMQFGRIDGSAYILDFQYPFSAVQAFAVALANVTQRLK
NT seq 4830 nt   +upstreamnt  +downstreamnt
atgtatgcagcggtggagcatgggcctgtcctgtgcagcgactccaacatcctctgcctg
tcctggaagggccgtgtccccaagagtgagaaggagaagcccgtgtgccgcaggcgctac
tacgaggagggctggctggccacgggcaatgggcgcggcgtagttggggtgaccttcacc
tccagccactgtcgccgggacagaaacactccacagagaatcaacttcaacctgcgaggc
cacaatagtgaggttcaggaagacccgtcacagagtactgctcttacagaagaagtcagc
gcatactttgtccttgctgtgcactctgtcatccatggcttccttgcagcaggacaaatg
gttgtgctggtgaggtggaacgagccgtaccagaagctggccacatgcgacgcggatggc
gggatattcgtatggatccagtacgagggccggtggtctgtggagctggtcaatgaccga
ggtgcccaggtgagcgatttcacgtggagccacgatgggacgcaagcactgatctcatat
cgagatgggtttgtcctggttggttctgtcagtggacaaagacactggtcatctgagatc
aacttggaaagtcagatcacctgtggcatatggacacctgacgaccagcaggtactgttc
ggcaccgccgacggacaggtgatcgtcatggactgccatggccggatgctggcccacgtc
ctgctgcacgagtcggatggcatcctcagcatgtcctggaactaccccgccttcctggtg
gaggacagcagcgagagcgacaccgactcggacgactactccccgccccaagatggtccg
gcagcgtaccccatcccggtgcagaacatcaagcccctgctcactgtcagcttcacctcc
ggagatatcagcctgatgaacagctatgacgacttgtctcccaccatcatccagtcaggg
ctgaaagaggtggtggcccagtggtgcacgcagggagacctcctggcagttgctggtatg
gagcgcccaagccagttcagtgacctccccaatggccctcttctgaagagtgccatggtc
aagttctacaacgttcgtggggagcacatctttaccctggacacgcttgtgcaacgcccc
atcgtgtccatctgctggggacaccgggactcacggctgctgatggcttcgggaccggcc
ctgtacgtggtgcgcgtggagcaccgggtgtccagcctgcagctgctgtgccagcaggcc
atcgccagcgccctgcgtgaggacaaggacgtcaacaagctgaccctgcccccccgcctt
tgctcctacctctccactgccttcattcccaccatcaagtccgcccctcgtgtccgtgtc
caaggcagattggtcctgggtgatggaactgatcctctcgtggcacagcccccaattcca
gaccccaacaacatgcgggacttcgtcagttacccgtcggctggcagcgagcggctgcac
tgcaccatgaagcgcacagaggacgacccggaggtgggcggcccgtgctacacactctac
ctggagcacctgggcgggctggtccccatcctcaagggccggcgcgtcagcaagcttcgg
cccgagttcgtcatcatggacccgcggaccgacagccgagcagatgaaatctatggaaac
agcttgatttccaccatgatcgacagctgcaactgctcagactccagcgacattgaactg
agtgatgactgggctgccaagaagtctcccaaaatctcccgagctagcaaatcacccaaa
ctcccaaggatcaacatcgaggcccggaagtcccccaagctgtctcgcgccgctcaggag
ctctcccgctctcctcgcctgcccatgcgcaagccgtccatcggctcacccagcctggcg
cggagggagttcccctttgaagatatcactcagcacaactatctcgctcaggtcacgtct
aatatctggggaaccaaatttaagatcgtgggcttggctgctttcctgccaaccaacctc
ggtgcagtaatctacaaaactagcctcctgcatctccagccgaggcagatgactatctat
ctcccagaggttcggaagatttccatggactacgttaatttacctgtcttcaacccaaat
gttttcagtgaagatgaagatgacttgccagtgacaggagcatctggtgtacccgaaaac
aacccgccctgtaccgtgaacatccccatcgcccccatccacagctcagctcaagccatg
tcccccacgcagagcatcgggctggtgcagtccctgctggccaaccagaatgtgcagctg
gacgtcctgaccaatcagaccacagccgtgggcggtgccgagcacgcgagtgagagtgct
gcccagtaccccgtgtccagccagtaccccgtgtccagccgctactccaaccccggccag
gtgatctttggaggcgtggagatgggccgcggcctccccaacccacctcagctctccctg
ccaccgccagcccaggggaccatccagctgtccgtgctagaccttggcgacagagaccac
gagcatctgcaaaagccagccaaggccctgcggccggtgccccagttggccactgagggg
gatgccgtggtgttcagtgccccccaggaggtccaggtggccaagatgaaccccccgccc
ccctaccccggaaccatccccgccgcccctaccacggcggcgccgccacccccgctgccg
cccccgcagcccccggtggacacgtgcttgaagaagggcgacttctctctgtaccccaca
gcggcgcattaccagccgcccctgggctacgagcggatcaccaccttcgacagcagcggc
aacgtggaggaggtgtgcaggccccggacgcggatgctctgctcccagaacacctacacg
ctgcccggcccgggcagctcggccacgctgaggctcacggccaccgagaagaaggtccca
cagccctgcaccagcgccacccttaaccgcctgacggtaccgcgctactccatccccccg
ggggacccgccgccctaccccgacctctccggccagcttggccccagccggggcgcgggg
cagaggccagacggcggcctcatccacgccacgctgcgcaggaacaaccgcgaggcggcg
ctccgggcggcgcagctggcggagctcccgcggccgccgccgcacccgcccaagcccaag
ggcacggcgcccttccccgcgcggccgccgcccgcgctctacacctgcagccagtgcagc
ggcgcagggggcgcggcgggccggcccgacccgggggcgcagccgggcgccagcctggcg
cacgcggccagcacctctccgctgacctcccagtcgtcctacaaccttctgggcgcggcc
gaaggcgcccgcgagcgtgctgactacgtgaactcggccttcactgaggacgaggcgctg
gcccagcactgtccagccgacaagccgccgaggcacccggcgctgggcgaggccgctgtg
gccgttaagcggccgcccccctaccagtgggaccccgtgctgggggaggatgtgtgggtc
cctcaggaaaggacagcccagagcacggtgcccaaccccctgaaactgccccctctggtg
gtgggtccaggccagcacctagacgtgtcccgagtgcccttcgtctcccccaaggttcct
gccagccctgctgccactttccagcccggctatgggatgggggtgccctactcggccggc
tgcagcacctccccgctgccaggggtgcaagctccctgctccccgaaagacgccctggcc
gcagcacagtttgctcagcaggagtccaccgtggttctgcagcccgcctacccgcccagc
ctggcctattgcaccctgccccccatgtacccgggaagcagtgcctgctccagtttacag
ctgccccctattgccttgcacccctggaactcctacagcccctgcccccccgtgcagaac
ccccagggcactctcccccccaaggcacacttggtggtggagaagcccctggtgtcccca
ccgcccactgacctccaaagccacctggggacagaggtgatggtggagaccgcagacaac
ttccaggaagtcctctccctgacggagagcccgatcccccagcggacagagaaattcggg
aagaagaaccgaaagcggctggacagcagggcagaggagggcaatgttcaggccatcacc
gagggcaaggtgaagaaggaggctcggacgctgagcgactttaattccctcatctccagc
ccccgcttggggagagagaagaagaaagtgaagagtcagaaggaccagctgaagtccaag
aagctgaataagacgaacgagttccaggacagctcagagagcgagccggagctcttcatc
agtggggatgagctgatgaaccagagccagggcagcaagaagggctggaagagcaagagg
agcctgcgggcggccagcgagctggaggagttcaagtgcaggaaggccagcgagaaggag
gacggccggctgggcagccagggctttgtgtacgtcatggccaacaagcagccgctctgg
aatgaggccacccaggtgtaccagctggacttcggggggcgggtgacccaggagtcggca
aagaacttccagatcgagctggaggggcggcaggtgatgcagttcgggaggatcgacggc
agcgcctacatcctggatttccagtaccccttctctgccgtgcaggccttcgcggtcgcc
ctggccaacgtgactcagcgcctcaagtga

DBGET integrated database retrieval system