KEGG   Bos taurus (cow): 100295732Help
Entry
100295732         CDS       T01008                                 

Gene name
MAP2K5
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 5
  KO
K04463  mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04540  Gap junction
bta04722  Neurotrophin signaling pathway
bta04921  Oxytocin signaling pathway
bta05418  Fluid shear stress and atherosclerosis
Module
bta_M00690  MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100295732 (MAP2K5)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100295732 (MAP2K5)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100295732 (MAP2K5)
  Nervous system
   04722 Neurotrophin signaling pathway
    100295732 (MAP2K5)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100295732 (MAP2K5)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100295732 (MAP2K5)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: STE group
  STE7 family
   100295732 (MAP2K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PB1 Kinase-like Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 100295732
NCBI-ProteinID: NP_001193699
Ensembl: ENSBTAG00000000218
VGNC: 31186
Position
10
AA seq 448 aa AA seqDB search
MLWLLLGPFHAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTIMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKIPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV
QFNDGNATVVSMWVCRALEERRSQQGPP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctgctccttggccccttccatgccatggagaaccaagtgctggtgattcgc
atcaagattcccaatagtggagcagtggactggacagtgcactctgggccgcagctactc
ttcagggatgtgctggatgtgataggccaggttctgcctgaagcaacaaccacagcattt
gaatacgaagatgaagatggtgatcgaattacagtgagaagtgatgaagaaatgaaggca
atgctgtcatattattattctacaataatggaacagcaagtaaatggacagttaatagag
cctctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatacccgggctggaccctctcaacacagcagcccagccgtctcagattcactt
ccaagcaatagcttaaagaagtcttctgccgaactgaaaaaaatattagccaatggccag
atgaatgaacaagacatacggtatcgagacactcttggtcatggcaacggcggcacagtc
tacaaagcatatcatgtcccaagtgggaaaatactagctgtaaaggtcatactactagat
attacactggaacttcagaagcaaattatgtctgaattggaaattctttataagtgtgat
tcatcatatatcataggcttttatggtgcatttttcgtggagaacaggatttcaatatgt
actgaatttatggatggaggctctttggatgtatatagaaaaattccagagcatgtcctt
ggaagaattgcagtggcggttgttaaaggccttacttatttgtggagtttaaagatttta
catagagatgtgaagccctccaatatgctagtaaacacaagaggacaagtcaagctgtgt
gattttggagttagcactcagctggtgaattctatagccaagacgtatgttggaacaaat
gcttatatggcgcctgaaagaatttcaggggagcagtatggaattcattctgatgtctgg
agcttaggaatctctttcatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagcttctgcagtgcattgttgatgaggattcg
cccgtccttccggttggagagttctccgagccatttgtacatttcatcactcagtgcatg
cgaaagcagccaaaagaaaggccggcacctgaggaactgatgggccacccattcatcgtg
cagttcaatgacggaaacgccaccgtggtgtccatgtgggtgtgcagggcgctggaggag
aggcgaagccagcagggccccccctga

DBGET integrated database retrieval system