KEGG   Bos taurus (cow): 100297753
Entry
100297753         CDS       T01008                                 

Gene name
TPC3
Definition
(RefSeq) two pore channel 3
  KO
K16897  two pore calcium channel protein 3
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    100297753 (TPC3)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, two-pore (TPC)
   100297753 (TPC3)
Motif
Pfam: Ion_trans
Other DBs
NCBI-GeneID: 100297753
NCBI-ProteinID: NP_001155123
Ensembl: ENSBTAG00000046419
UniProt: C4IXV8
Position
11
AA seq 768 aa
MPGNSRAAGTHHSRPSSSEEPPDLEDQELLLAAAYVSDAQYNRNVPFETSPQAIRLYHFY
NHWTMRAATYFFIWVNLALALFEEPAVFPLPFLVTSIAEVLCLTAFFGRLVHFAKVTPQK
VFWKDTKNICVMVTIVLTLIDLVIYGSLEAVNIRGVRWSRALRPVFLINFPESRQIRRTF
RSIRNTLPDILYVFLLFLFSMMIFSLMALKLFGDRDLRTVEGSPYFTNILDIAFELYVLV
TTANSPDVMMPAYELNWWYSLYFITYIIINTYIFMSVFLAVIYNNYRKHLKNEIHTLAYL
KHHKMTEAFNILKVKVGTEFVVKEARWRRLVKVVAPDVSSSHLELLLRISDEGQKGHVDK
VNFLRLADLLNIRVVAINIKKHPLETWMPRVYQSSTSLLVQKMVQHRIFVWVYDVIILIN
AIFIALDEKDSLISYAEWLFLSLYIIEILLKLYTYEPSAYFGRKQFWNWFDTLIIIAALL
ATVANTTIQARKYNSQQVLDIVLILRILRLLRVIVSIQRFRVIVTTLINIGPTMLTFGGL
VLVVYYAFAIIGMEVFHGKIHFLDPGSGSPDALVCGNPALKDSAFAQGRYCKNNFNDLAS
SLILLTELTVVNQWHILADGFALVTHQAAKLYFIGFHVVVVILIVNIFIAFILEAFFVAY
SLEKSEVETAIEKKIQELGVGVQEEEVQDGGLIDNMDAKDSGFSPDEGDNKKKDLKGLYF
RIASKKYKTVDTLLQQMFESEIAPEGKDPSLKEILSFSPKKVNFDNSA
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgcccgggaacagccgagccgcggggacccatcactcgcgcccgtcgtcctccgaggag
ccgcccgacctggaggaccaggagcttctcctggcagctgcctatgtctcggatgcccag
tacaacagaaacgttccgtttgagacatcccctcaggccatcagactttaccacttctat
aaccactggacgatgcgggcagccacctacttcttcatttgggtcaaccttgcgcttgcc
ctctttgaggaaccagccgtgttcccgctccctttcttggttacctcgatagcagaagtg
ctctgtctgactgccttctttgggagactggttcactttgccaaggtcactcctcagaag
gtcttctggaaggatacaaaaaacatctgcgtcatggtaaccatagtgctgaccttgatt
gatctggtcatctatgggtccctggaagctgttaacatccgcggagttcgatggtcaagg
gccttgaggccagtcttcctcatcaacttccctgaaagtcgtcagatccgaaggactttc
cgaagcatccggaacactctgcccgacatcctctacgtgttcctcttgttcctcttcagt
atgatgattttctccctcatggccctgaagcttttcggggatagggatcttaggactgtg
gaagggtcaccgtacttcaccaacatcctggacatagcgtttgagctctacgtgctggtc
accactgcaaacagccctgacgtcatgatgcctgcctacgagctcaactggtggtattct
ctgtactttataacctacatcatcatcaacacctacatcttcatgtctgtctttctggct
gttatctacaacaactacaggaagcacttgaagaatgagattcacacactggcatacctg
aaacatcacaaaatgacggaagctttcaacatcctgaaagtcaaggtgggcacagagttt
gtggtgaaggaggcccggtggaggcggctggtcaaggtggtggcaccagacgtcagcagt
tcccacctggagctcctgttgaggatctccgacgagggacagaaggggcacgtggacaaa
gtgaactttctacgcttggctgacctcctcaacatccgggtagtcgccatcaacatcaag
aaacacccactggaaacttggatgcctcgggtataccagtcatccacaagcctcttggtc
cagaagatggttcaacacaggatttttgtctgggtttacgatgtcatcattctaataaat
gccatattcattgctttggatgagaaggactccttaatttcctacgcagaatggcttttc
ctttctctatatatcattgagattctcctgaaattgtacacgtatgaacccagcgcttat
tttggaaggaagcagttctggaactggttcgacacgctgatcatcatcgcagccctgctg
gccactgtggccaacaccaccattcaagcgagaaaatacaacagtcagcaggtactggat
attgtcttgattttgagaatactccggctccttcgggtcatcgtcagcatccagaggttt
cgggtgatcgtgaccaccttaattaacattggccccacaatgctgacattcggcggcctg
gtcttggtggtctactacgcatttgccatcattgggatggaagtgttccacggcaaaatc
cacttcctggaccccggttctggcagtcctgatgccctggtgtgtgggaacccagcctta
aaagactcagcatttgcccaaggcaggtactgcaagaacaacttcaacgacctggcatcc
tcactcatcctgctgacggagctcaccgtggttaaccagtggcacatcctcgcggacggc
tttgccctcgtgacacaccaggcagcaaagctgtatttcatcggcttccacgtggtggtc
gtcattctcattgtgaatattttcatagcgttcatcttggaggcgttttttgtggcatat
tcgttagaaaagagtgaagtggaaactgccattgagaagaagattcaggagcttggagtg
ggggtccaagaggaagaggtgcaggacggggggctcattgacaacatggacgccaaggac
agtggcttcagtccggacgaaggagacaacaaaaagaaggacttgaaaggactgtacttc
agaattgcatcaaaaaagtacaagacggtggacactttgttacagcagatgtttgagtct
gaaatagctccagagggtaaagacccttccttgaaggagattctcagcttctcacccaag
aaggtcaattttgataacagcgcctga

DBGET integrated database retrieval system