KEGG   Bos taurus (cow): 100336575Help
Entry
100336575         CDS       T01008                                 

Gene name
MMP8
Definition
(RefSeq) neutrophil collagenase
  KO
K01402  matrix metalloproteinase-8 (neutrophil collagenase) [EC:3.4.24.34]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.34  neutrophil collagenase
     100336575 (MMP8)
Peptidases [BR:bta01002]
 Metallo Peptidases
  Family M10
   100336575 (MMP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_4 Reprolysin_5 Reprolysin_3 DUF4953 Metallopep
Motif
Other DBs
NCBI-GeneID: 100336575
NCBI-ProteinID: XP_024831456
Ensembl: ENSBTAG00000046732
VGNC: 31530
Position
15
AA seq 436 aa AA seqDB search
MFSLKMLPLLLLLHVQLSRAFPVSFASLEEKNRNIVQNYLEKFYQLPRFKYKSERKSKTN
VIVETLKRMQQFFGLNVTGKPNEETLEMMRKPRCGVPDSGSFMRTPGNPKWEKTKLTYRI
VNYTPNLTEMDVEAIIEEAFKVWSKVSPLTFNRTLDEEADIQISFAQRDHGDNSPFDGPD
GILAHAFQPGPGIGGDVHFDAEETWTKTSENYNLFPVAAHEFGHSLGLAHSSDPGALMYP
NYAFIDPSSYSLHQDDINGIQAIYGPSSNPVQPTGPTTPTACDPRLTFDAVTTLRGEILF
FKDKYVWRKHPRLRMAEFNFISLYWPSLPNGIQAAYEDFDRDLIFIFKGTQYWALSGYDT
QQGYPKHISSYGLPSSVQAIDAAVSYRRKTYFFVNDQFWSYDDQSQSMEPGYPQSIASFF
PGIESRVDAVFQENCK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcctgaagatgctcccacttctgctcttactccacgtgcagctttccagggcc
tttccagtatcttttgcatccctagaagagaaaaacagaaacattgttcagaattaccta
gagaagttctaccaattgccaaggttcaaatataagtctgaaaggaagagcaaaactaat
gtgattgttgagacacttaaaagaatgcagcaattcttcgggctgaacgtgacagggaag
ccaaatgaggaaaccctggagatgatgagaaagcctcgctgtggagtgcccgactcgggc
agctttatgagaaccccaggaaaccccaagtgggaaaaaactaagctgacctacaggatt
gtgaactataccccgaacttgacagagatggatgtggaagcaattattgaggaagccttt
aaagtctggagtaaagtgtcacccttgaccttcaacaggaccttggacgaagaagcagac
atccagatttcttttgcccaaagagatcatggggacaattccccatttgatggacccgat
ggaattcttgctcatgcctttcagccaggccctggtattggaggagatgttcattttgat
gcagaagaaacatggaccaaaacctctgaaaattacaacttgtttcctgttgctgcccat
gaattcggccattccttggggctggctcactcctctgatcctggggccttgatgtatccc
aattatgctttcattgaccccagcagctactcactgcatcaagatgacatcaatggcatt
caggccatctacggaccctcaagcaaccctgtgcaacctactggaccaaccacccccacc
gcctgcgaccccagactgacgtttgatgctgtcaccacactccgtggagaaatactcttc
ttcaaagacaagtacgtctggaggaagcaccctcggctacgaatggcggaattcaatttc
atttctctctactggccgtccctgccaaacggcatacaggctgcttatgaggattttgac
agggacctaattttcatattcaaaggcacccagtactgggctctgagtggctatgatact
cagcaaggttaccccaagcatatatcaagctatggcttgccgagcagtgtccaagcaatt
gacgcagctgtttcctacaggagaaaaacgtacttctttgtaaacgaccagttctggagc
tatgatgaccaaagtcaatctatggaaccaggttatccccaaagcatagcaagttttttt
ccaggaatagaaagtagagttgatgcagttttccaggagaattgtaagtag

DBGET integrated database retrieval system