KEGG   Bos taurus (cow): 100848234Help
Entry
100848234         CDS       T01008                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: olfactory receptor 8S1-like
  KO
K04257  olfactory receptor
Organism
bta  Bos taurus (cow)
Pathway
bta04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    100848234
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    100848234
G protein-coupled receptors [BR:bta04030]
 Others
  Chemoreception
   Olfactory
    100848234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 100848234
NCBI-ProteinID: XP_010803357
Position
5
AA seq 309 aa AA seqDB search
MKNVSIITEFVLLGLSSDPQIQTVLFVLFLGIYLLTLVGNTVMILIIKVDARLHTPMYFF
LGHLSFLDLSFSSVTVPKMLQNFLSQKKSISVWGCITQXFFFTLSGGTEACLLSAMAYDR
YAAICHPLLYTVVINRPLCTGIVSTAWAVGFSISLMNSLFVHKLHFCGSNIIPHFSCELP
PLFPLSCTDPTVNEILLAVSCTSLGLLTLPPILFSYSRIISAILSIRSTEGQGKAFSTCS
SHLTVVLLFYGTALFRYISPDSGSVLERVVSIQYSVITSLLNPLIYSFKNQEVKTALQRL
LRQQKCASR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtcagtattattacggagtttgtccttctgggattgtccagtgacccccag
atccagaccgtgctctttgtgctgttcctggggatttacctgctgacattagtgggcaac
acagtgatgatcctgatcatcaaggttgatgctcggctccacacacccatgtatttcttc
ctcggacacctgtcttttctggatctcagtttctcctcagtcactgtgcccaaaatgcta
cagaacttcttgtctcagaagaaaagtatctcagtgtggggctgcatcactcagnntttc
tttttcactctctcaggggggacagaagcctgtcttctctctgccatggcctacgaccgc
tatgctgctatctgccaccctctgctctacactgtggtcataaacagacctctctgcact
gggattgtgagcacagcttgggcagtgggattttctatttccttgatgaatagcctcttt
gttcacaagttacatttttgtggttccaacatcatcccccatttcagttgtgagctacct
ccactcttccctctgtcttgtactgaccccactgtcaatgagattcttctagctgtgtca
tgcacatctttagggctgctgacacttcccccaatcctcttttcttactcaagaatcatt
tctgccatactgagtatccgctccactgagggccaaggcaaggccttttccacctgttcc
tcccacctcactgtggtgctcctgttctacgggacggctctgttcaggtacatcagccct
gactcaggctcagtgttggagcgagtggtctccattcagtatagtgtgatcacttccttg
ctgaacccccttatctacagcttcaagaaccaggaggtaaaaacagctctacagcgactg
ctgaggcaacagaagtgtgccagcaggtaa

DBGET integrated database retrieval system