KEGG   Bos taurus (cow): 280712Help
Entry
280712            CDS       T01008                                 

Gene name
ADA
Definition
(RefSeq) adenosine deaminase
  KO
K01488  adenosine deaminase [EC:3.5.4.4]
Organism
bta  Bos taurus (cow)
Pathway
bta00230  Purine metabolism
bta01100  Metabolic pathways
bta05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    280712 (ADA)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    280712 (ADA)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.4  adenosine deaminase
     280712 (ADA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: A_deaminase
Motif
Other DBs
NCBI-GeneID: 280712
NCBI-ProteinID: NP_776312
BGD-bta: BT12388
Ensembl: ENSBTAG00000005280
VGNC: 25600
UniProt: P56658
Structure
PDB: 

Position
13
AA seq 363 aa AA seqDB search
MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPE
FLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQA
EGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAI
DLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGY
HTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIF
KSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAE
QCL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcccagacgcccgccttcaacaagcccaaagtagaactgcatgtccacctggatgga
gccatcaagcccgaaaccatcttatattatggcaggaagaggggcatcgccctccccgcc
gacacgccagaggagctacagaacatcatcggcatggacaagccacttagcctcccagag
ttcctggccaagttcgactactacatgcctgccattgcgggctgccgggaggctgtcaaa
aggattgcctacgagtttgtggagatgaaggccaaggacggcgtggtgtatgtggaggtg
cgctacagcccacacctgctggccaactccaaggtggagccgatcccctggaaccaggct
gaaggggacctcaccccggatgaggtggtgtcactggtgaaccagggcctgcaggagggg
gagcgggacttcggcgtgaaggtgcggtccatcctgtgctgcatgcgccaccagcccagc
tggtcctctgaggtggtggagctgtgtaagaagtaccgagagcagaccgtggtggccatt
gacctggctggagatgagaccattgaaggcagcagcctcttccctggacatgtgaaggcc
tatgcggaggccgtgaagagcggcgtccaccgcacggtccacgccggggaagtgggctcg
gccaatgtggtgaaagaggccgtggacacactcaagaccgagaggctggggcatggctac
cacaccctggaggatgccaccctttacaacaggctgcggcaggaaaacatgcacttcgag
gtctgcccctggtccagctacctcaccggcgcctggaagcccgacacggaacacccggtt
gttcggttcaaaaacgaccaggttaactactcgctcaacacggatgacccgctcatcttc
aagtccacgctggacacggattaccagatgaccaagaatgaaatgggcttcaccgaagag
gagtttaagagactgaacatcaatgcggccaagtccagtttcctccctgaagatgagaag
aaggagcttcttgatctgctctataaggcctacgggatgccctctccggcctctgcagag
cagtgtctgtga

DBGET integrated database retrieval system