KEGG   Bos taurus (cow): 280717Help
Entry
280717            CDS       T01008                                 

Gene name
ALB
Definition
(RefSeq) serum albumin precursor
  KO
K16141  serum albumin
Organism
bta  Bos taurus (cow)
Pathway
bta04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    280717 (ALB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    280717 (ALB)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   280717 (ALB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serum_albumin VitD-bind_III
Motif
Other DBs
NCBI-GeneID: 280717
NCBI-ProteinID: NP_851335
BGD-bta: BT11285
Ensembl: ENSBTAG00000017121
UniProt: P02769 A0A140T897
Structure
PDB: 

Position
6
AA seq 607 aa AA seqDB search
MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPF
DEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEP
ERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYY
ANKYNGVFQECCQAEDKGACLLPKIETMREKVLTSSARQRLRCASIQKFGERALKAWSVA
RLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKE
CCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRR
HPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEK
LGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLIL
NRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLP
DTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVV
STQTALA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgggtgacttttatttctcttctccttctcttcagctctgcttattccaggggt
gtgtttcgtcgagatacacacaagagtgagattgctcatcggtttaaagatttgggagaa
gaacattttaaaggcctggtactgattgccttttctcagtatctccagcagtgtccattt
gatgagcatgtaaaattagtgaacgaactaactgagtttgcaaaaacatgtgttgctgat
gagtcccatgccggctgtgagaagtcacttcacactctctttggagatgaattgtgtaaa
gttgcatcccttcgtgaaacctatggtgacatggctgactgctgtgagaaacaagaacct
gagagaaatgaatgcttcttgtcacacaaagatgatagccctgatctacctaaactcaaa
cctgaccccaatactttgtgtgacgagtttaaggccgatgaaaagaagttttggggaaaa
tacctatacgaaattgctagaagacatccctacttttatgcaccagaactcctttactat
gctaataaatataatggagtttttcaagaatgctgccaagctgaagataaaggtgcctgc
ctgctaccaaagattgaaactatgagggaaaaggtactgacttcatctgccagacagaga
ctcaggtgtgccagtattcaaaaatttggagaaagagctttaaaagcatggtcagtagct
cgcctgagccagaaatttcccaaggctgagtttgtagaagttaccaagctagtgacagat
ctcacaaaagtgcacaaggaatgctgccatggagacctacttgaatgcgcagatgacagg
gcggaccttgccaagtacatatgtgataatcaagatacaatctccagtaaactgaaggaa
tgctgtgataagcctttgttggaaaaatcccactgcattgctgaggtagaaaaagatgcc
atacctgaaaacttgcccccattaactgctgactttgctgaagataaggatgtatgcaaa
aactatcaagaagcaaaggatgccttcctgggctcatttctttatgaatattcaagaagg
catcctgaatatgctgtctcagtgctattgagacttgccaaggaatatgaagccacactg
gaggaatgctgtgccaaagatgatccacatgcatgctattccacagtgtttgacaaactt
aagcatcttgtggatgagcctcagaatttaattaaacaaaactgtgaccaattcgaaaaa
cttggagagtatggattccaaaatgcgctcatagttcgttacaccaggaaagtaccccaa
gtgtcaactccaactctcgtggaggtttcaagaagcctaggaaaagtgggtactaggtgt
tgtacaaaaccggaatcagaaagaatgccctgtacagaagactatctgagcttgatcctg
aaccggttgtgcgtgctgcatgagaagacaccagtgagtgaaaaagtcaccaagtgctgc
acagagtcattggtgaacagacggccatgtttctctgctctgacacctgatgaaacatat
gtacccaaagcctttgatgagaaattgttcaccttccatgcagatatatgcacacttccc
gatactgagaaacaaatcaagaaacaaactgcacttgttgagctgttgaaacacaagccc
aaggcaacagaggaacaactgaaaaccgtcatggagaattttgtggcttttgtagacaag
tgctgcgcagctgatgacaaagaagcctgctttgctgtggagggtccaaaacttgttgtt
tcaactcaaacagccttagcctaa

DBGET integrated database retrieval system