KEGG   Bos taurus (cow): 280733Help
Entry
280733            CDS       T01008                                 

Gene name
BGN
Definition
(RefSeq) biglycan precursor
  KO
K08118  biglycan
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:bta00535]
    280733 (BGN)
Proteoglycans [BR:bta00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class I
    280733 (BGN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRRNT LRR_9 LRR_5
Motif
Other DBs
NCBI-GeneID: 280733
NCBI-ProteinID: NP_847888
Ensembl: ENSBTAG00000005250
VGNC: 26481
UniProt: P21809
Structure
PDB: 

Position
X
AA seq 369 aa AA seqDB search
MWPLWPLAALLALSQALPFEQKAFWDFTLDDGLPMLNDEEASGAETTSGIPDLDSLPPTY
SAMCPFGCHCHLRVVQCSDLGLKAVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYAL
VLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVF
SGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHN
KIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDL
KLLQVVYLHTNNITKVGVNDFCPVGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRL
AIQFGNYKK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtggcccctgtggcctcttgcagccctgctggccctgagccaggccctgccctttgag
caaaaagccttctgggacttcaccctggatgatgggctgcccatgctgaacgatgaggaa
gcttcgggtgcagaaacaacctcgggcatcccagacctggactccctcccacccacctac
agcgccatgtgcccttttggctgccactgccatctgagggttgttcagtgctccgacctg
ggtctgaaggctgtgcccaaggagatctcgcctgacaccaccctgctggacctgcagaat
aatgacatctctgagctccgaaaagatgacttcaaaggcctccagcacctctacgccttg
gtcctcgtgaacaacaagatctccaagatccacgagaaggccttcagccccctgcggaag
ctgcagaagctctacatctccaagaaccacctggtggagatccctcccaacctgcccagc
tccctggtggagctccgcatccatgacaaccgcatccgcaaggtgcccaagggcgtgttc
agtgggcttcgcaacatgaactgcattgagatgggtgggaaccccctggagaacagcggc
tttgaacctggagcatttgatggcctgaagctcaactaccttcgcatctccgaggccaag
ctcactggcatccccaaagacctccctgagaccctcaatgaactccacctggaccacaac
aaaatccaggcaatcgagctagaggatctgctccgctactccaagttgtacaggctgggc
ctgggccacaaccagatccgcatgattgagaacgggagcctgagttttctgcccacgctg
cgggagctgcacttggacaacaacaagctgtctagggtgccagctggtcttccagacctc
aagctcctccaggtggtctatctgcacaccaacaacatcaccaaggtgggcgtcaacgac
ttctgcccagtgggcttcggggtcaagagggcctactacaacggcatcagcctcttcaac
aaccccgttccctactgggaggtgcagccggccacctttcgctgcgtcactgaccgcctg
gccatccagtttggcaactataaaaagtag

DBGET integrated database retrieval system