KEGG   Bos taurus (cow): 280740Help
Entry
280740            CDS       T01008                                 

Gene name
CA2
Definition
(RefSeq) carbonic anhydrase 2
  KO
K18245  carbonic anhydrase 2 [EC:4.2.1.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00910  Nitrogen metabolism
bta01100  Metabolic pathways
bta04964  Proximal tubule bicarbonate reclamation
bta04966  Collecting duct acid secretion
bta04971  Gastric acid secretion
bta04972  Pancreatic secretion
bta04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    280740 (CA2)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    280740 (CA2)
   04972 Pancreatic secretion
    280740 (CA2)
   04976 Bile secretion
    280740 (CA2)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    280740 (CA2)
   04966 Collecting duct acid secretion
    280740 (CA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    280740 (CA2)
Enzymes [BR:bta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     280740 (CA2)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   280740 (CA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 280740
NCBI-ProteinID: NP_848667
BGD-bta: BT11203
Ensembl: ENSBTAG00000017733
UniProt: P00921
Structure
PDB: 

Position
14
AA seq 260 aa AA seqDB search
MSHHWGYGKHNGPEHWHKDFPIANGERQSPVDIDTKAVVQDPALKPLALVYGEATSRRMV
NNGHSFNVEYDDSQDKAVLKDGPLTGTYRLVQFHFHWGSSDDQGSEHTVDRKKYAAELHL
VHWNTKYGDFGTAAQQPDGLAVVGVFLKVGDANPALQKVLDALDSIKTKGKSTDFPNFDP
GSLLPNVLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSQQMLKFRTLNFNAEGEPELLM
LANWRPAQPLKNRQVRGFPK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatcactggggatacggcaagcacaacggccccgaacactggcataaggacttt
cccattgccaacggagagcgccagtcacccgttgacatcgacaccaaggccgtcgttcag
gatcctgctttgaagcctctggcccttgtctatggggaagcaacttcgcggagaatggtc
aacaatggtcactcttttaacgtggagtatgacgactcccaggacaaagcagtgctgaaa
gatggacctcttactggcacttacagattggttcagtttcactttcactggggctcatct
gatgaccaaggttctgagcatactgtggataggaagaaatatgctgccgagctacacctg
gttcactggaacaccaagtacggggactttggaacagcagcacagcagcctgatggactg
gctgttgtgggtgtttttttgaaggttggtgatgctaacccagccctccagaaagtcctt
gacgcgctggattctattaaaacaaagggtaagagcaccgacttccccaacttcgatccg
ggcagcctccttcctaacgtcttggactactggacctaccctggctcactgaccacccct
cctctcctcgaaagcgtgacctggatcgtgctcaaagaacccatctctgttagcagtcag
cagatgttgaaattccgtactcttaacttcaacgcggagggcgagcctgaactcctgatg
ttggccaactggcgtccggctcagccgctgaaaaacagacaagtcagaggtttccccaaa
taa

DBGET integrated database retrieval system