KEGG   Bos taurus (cow): 280741Help
Entry
280741            CDS       T01008                                 

Gene name
CA4
Definition
(RefSeq) carbonic anhydrase 4 precursor
  KO
K18246  carbonic anhydrase 4 [EC:4.2.1.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00910  Nitrogen metabolism
bta01100  Metabolic pathways
bta04964  Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    280741 (CA4)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    280741 (CA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    280741 (CA4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bta00537]
    280741 (CA4)
Enzymes [BR:bta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     280741 (CA4)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   280741 (CA4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bta00537]
 Enzymes
  280741 (CA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 280741
NCBI-ProteinID: NP_776322
BGD-bta: BT11512
Ensembl: ENSBTAG00000017969
VGNC: 26654
UniProt: Q95323
Position
19
AA seq 312 aa AA seqDB search
MRLLLALLVLAAAPPQARAASHWCYQIQVKPSNYTCLEPDEWEGSCQNNRQSPVNIVTAK
TQLDPNLGRFSFSGYNMKHQWVVQNNGHTVMVLLENKPSIAGGGLSTRYQATQLHLHWSR
AMDRGSEHSFDGERFAMEMHIVHEKEKGLSGNASQNQFAEDEIAVLAFMVEDGSKNVNFQ
PLVEALSDIPRPNMNTTMKEGVSLFDLLPEEESLRHYFRYLGSLTTPTCDEKVVWTVFQK
PIQLHRDQILAFSQKLFYDDQQKVNMTDNVRPVQSLGQRQVFRSGAPGLLLAQPLPTLLA
PVLACLTVGFLR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgctgctggcgctcctggtcctcgccgccgccccgccccaggcccgtgcagcg
tcacactggtgctaccagattcaagtcaagccttccaactacacctgcttggagccagac
gagtgggaaggcagctgccagaacaaccgccagtcccccgtcaacatcgtcacagccaag
actcagctggacccaaacctggggcgcttttccttttctggctacaacatgaagcaccag
tgggtcgtgcaaaacaacgggcatacagtgatggtgttgctggagaataagccctcgatc
gctggaggaggactgagcacccggtaccaagccacgcagctgcacctgcactggtccagg
gcgatggatcggggctcagagcacagcttcgacggggagcgctttgccatggagatgcac
atagtgcacgagaaagagaaggggctatccgggaatgcgagccagaaccagttcgccgaa
gatgagatcgcggtgctggccttcatggtggaggacggatccaagaatgtgaacttccag
cccctggtggaggcgctgtctgacatccccagacccaatatgaacaccacaatgaaagaa
ggcgtcagcctcttcgacctgctccccgaggaggagagtctgaggcactacttccgctac
ctgggctcgctcaccacaccgacctgcgacgagaaggtggtctggaccgtgttccagaag
ccaatacagctccacagggaccagatcttggccttctcccagaagctgttctatgacgac
cagcagaaagtgaatatgacggacaacgtcaggcccgtgcagagcctgggccagcgccag
gttttcaggtccggggccccgggactgctgctggcccagccgctgcccaccctgttggcc
cccgtgctcgcctgcttgacagtgggcttcctccggtga

DBGET integrated database retrieval system