KEGG   Bos taurus (cow): 280760Help
Entry
280760            CDS       T01008                                 

Gene name
DCN
Definition
(RefSeq) decorin precursor
  KO
K04660  decorin
Organism
bta  Bos taurus (cow)
Pathway
bta04350  TGF-beta signaling pathway
bta05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    280760 (DCN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    280760 (DCN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:bta00535]
    280760 (DCN)
Proteoglycans [BR:bta00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class I
    280760 (DCN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRNT LRR_6 STAR_dimer
Motif
Other DBs
NCBI-GeneID: 280760
NCBI-ProteinID: NP_776331
BGD-bta: BT11518
Ensembl: ENSBTAG00000003505
VGNC: 27918
UniProt: P21793
Structure
PDB: 

Position
5
AA seq 360 aa AA seqDB search
MKATIIFLLVAQVSWAGPFQQKGLFDFMLEDEASGIGPEEHFPEVPEIEPMGPVCPFRCQ
CHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISK
ISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVV
ELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAA
SLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYL
HNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQLGNYK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaactatcatctttctcttggttgcacaagtttcctgggctggaccatttcaa
cagaaaggcttatttgactttatgctggaagatgaggcttctgggataggcccggaagag
cactttcctgaagttcctgaaatagagcctatgggcccagtctgccccttccgctgtcag
tgccatctgcgagttgtccagtgttctgatctgggtctggaaaaagtaccaaaagacctt
cctcctgatactgcgctgctggacctgcaaaacaacaaaataactgagatcaaagatgga
gactttaagaacctgaagaaccttcatacactgattctcatcaacaacaaaattagcaaa
atcagccctggggcatttgctcctttggtgaaattggaacgactttatctttccaagaat
caactgaaggaattgccagagaaaatgcccaaaactcttcaggagctgcgtgtccatgag
aacgagatcaccaaagtgcgaaagtctgtgttcaatggattgaaccagatgatcgtcgta
gaacttggcaccaacccgctgaagagctcaggcattgaaaatggagcctttcagggaatg
aagaagctctcctacatccgcattgctgacacaaatataactaccatccctcaaggtctt
cctccttcccttactgaattacatctcgatggcaacaaaatcaccaaagttgatgcagct
agcctgaaaggactgaataatttggctaagttgggactgagtttcaacagcatctctgcg
gttgacaatggctctttggccaacactcctcatttgagggaacttcatttgaacaacaac
aagcttgtcaaagtgcccggtgggctggccgatcataagtacatccaggttgtctacctt
cacaacaacaatatctctgcaatcggctctaacgacttctgcccacccggatacaacacc
aaaaaggcttcttattcaggagtgagccttttcagcaacccagtccagtactgggagatc
cagccatccaccttccgatgtgtctatgtgcgtgctgccgttcagcttggaaactacaag
tag

DBGET integrated database retrieval system