KEGG   Bos taurus (cow): 280763Help
Entry
280763            CDS       T01008                                 

Gene name
DDO
Definition
(RefSeq) D-aspartate oxidase
  KO
K00272  D-aspartate oxidase [EC:1.4.3.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00250  Alanine, aspartate and glutamate metabolism
bta01100  Metabolic pathways
bta04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    280763 (DDO)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    280763 (DDO)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.1  D-aspartate oxidase
     280763 (DDO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO NAD_binding_8 Thi4 FAD_binding_2 Pyr_redox Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 280763
NCBI-ProteinID: NP_776333
BGD-bta: BT25300
Ensembl: ENSBTAG00000033367
VGNC: 27951
UniProt: P31228
Position
9
AA seq 341 aa AA seqDB search
MDTVRIAVVGAGVMGLSTAVCISKMVPGCSITVISDKFTPETTSDVAAGMLIPPTYPDTP
IQKQKQWFKETFDHLFAIVNSAEAEDAGVILVSGWQIFQSIPTEEVPYWADVVLGFRKMT
KDELKKFPQHVFGHAFTTLKCEGPAYLPWLQKRVKGNGGLILTRRIEDLWELHPSFDIVV
NCSGLGSRQLAGDSKIFPVRGQVLKVQAPWVKHFIRDSSGLTYIYPGVSNVTLGGTRQKG
DWNLSPDAEISKEILSRCCALEPSLRGAYDLREKVGLRPTRPSVRLEKELLAQDSRRLPV
VHHYGHGSGGIAMHWGTALEATRLVNECVQVLRTPAPKSKL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggatacagtacggattgcagttgtgggggctggcgtgatggggctttctaccgctgtg
tgcatttccaaaatggtcccaggatgctccattacagtcatttcagacaaattcactcct
gagaccacgagtgatgtggcagctggaatgcttattcctcctacttatccagacacaccc
attcagaagcagaagcagtggttcaaagagacctttgatcacctgtttgcaatagtcaat
tctgcagaagctgaagatgctggtgttattttggtgtctggttggcagatatttcagagt
attcctactgaagaagtgccatactgggctgacgtggtgctaggatttcgaaagatgacc
aaggatgagctgaagaaattcccccaacatgtgtttggtcatgcttttacgacactcaag
tgtgaaggccctgcctacctcccgtggttgcagaaaagggtaaaaggaaatgggggcctg
atactcacccgacgaatagaagacctgtgggagcttcacccgtccttcgacatcgtggtc
aactgttcaggccttggaagcaggcagcttgcaggagactcaaagattttcccagtgagg
ggccaagtactcaaagtgcaggctccctgggtcaagcactttatccgagatagcagtggg
ctgacatatatttaccctggcgtatccaatgtaaccctgggtggcactaggcaaaaagga
gactggaatttgtccccagatgcagaaattagcaaagagattctttcccgatgctgtgcc
ctcgagccctctctccgtggagcctatgacctaagagagaaagtgggtttgaggcccact
aggccaagcgtacggctggagaaagagctactagctcaggacagccggaggctgcctgtg
gtccatcactatggccatggaagtgggggcatcgccatgcactggggcactgctctggag
gccaccaggctggtgaacgagtgtgtccaagtccttaggactcctgctcccaagtcaaag
ctgtag

DBGET integrated database retrieval system