KEGG   Bos taurus (cow): 280787
Entry
280787            CDS       T01008                                 

Gene name
F10
Definition
(RefSeq) coagulation factor X precursor
  KO
K01314  coagulation factor X [EC:3.4.21.6]
Organism
bta  Bos taurus (cow)
Pathway
bta04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    280787 (F10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bta01002]
    280787 (F10)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bta00536]
    280787 (F10)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.6  coagulation factor Xa
     280787 (F10)
Peptidases and inhibitors [BR:bta01002]
 Serine peptidases
  Family S1: chymotrypsin family
   280787 (F10)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   280787 (F10)
SSDB
Motif
Pfam: Trypsin Gla FXa_inhibition EGF Trypsin_2 DUF1986 cEGF hEGF EGF_3 EGF_CA
Other DBs
NCBI-GeneID: 280787
NCBI-ProteinID: NP_001073682
BGD-bta: BT23406
Ensembl: ENSBTAG00000016385
VGNC: 28677
UniProt: P00743
Structure
PDB: 

Position
12
AA seq 492 aa
MAGLLHLVLLSTALGGLLRPAGSVFLPRDQAHRVLQRARRANSFLEEVKQGNLERECLEE
ACSLEEAREVFEDAEQTDEFWSKYKDGDQCEGHPCLNQGHCKDGIGDYTCTCAEGFEGKN
CEFSTREICSLDNGGCDQFCREERSEVRCSCAHGYVLGDDSKSCVSTERFPCGKFTQGRS
RRWAIHTSEDALDASELEHYDPADLSPTESSLDLLGLNRTEPSAGEDGSQVVRIVGGRDC
AEGECPWQALLVNEENEGFCGGTILNEFYVLTAAHCLHQAKRFTVRVGDRNTEQEEGNEM
AHEVEMTVKHSRFVKETYDFDIAVLRLKTPIRFRRNVAPACLPEKDWAEATLMTQKTGIV
SGFGRTHEKGRLSSTLKMLEVPYVDRSTCKLSSSFTITPNMFCAGYDTQPEDACQGDSGG
PHVTRFKDTYFVTGIVSWGEGCARKGKFGVYTKVSNFLKWIDKIMKARAGAAGSRGHSEA
PATWTVPPPLPL
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggcgggcctgctgcatctcgttctgctcagcaccgccctgggcggcctcctgcggccg
gcggggagcgtgttcctgccccgggaccaggcccaccgtgtcctgcagagagcccgcagg
gccaactcattcttggaggaggtgaagcagggaaacctggagcgagagtgcctggaggag
gcctgctcactagaggaggcccgcgaggtcttcgaggacgcagagcagacggatgaattc
tggagtaaatacaaagatggagaccagtgtgaaggccacccgtgcctgaatcagggccac
tgtaaagacggcatcggagactacacctgcacctgtgcggaagggtttgaaggcaaaaac
tgcgagttctccacgcgtgagatctgcagcctggacaatgggggctgcgaccagttctgc
agggaggagcgcagcgaggtgcggtgctcctgcgcgcacggctacgtgctgggcgacgac
agcaagtcctgcgtgtccacagagcgcttcccctgtgggaagttcacgcagggacgcagc
cggcggtgggccatccacaccagcgaggacgcgcttgacgccagcgagctggagcactac
gaccctgcagacctgagccccacagagagctccttggacctgctgggcctcaacaggacc
gagcccagcgccggggaggacggcagccaggtggtccggatagtgggcggcagggactgc
gcggagggcgagtgcccatggcaggctctgctggtcaacgaagagaacgagggattctgc
gggggcaccatcctgaacgagttctacgtcctcacggctgcccactgcctgcaccaggcc
aagaggttcacggtgagggtcggcgaccggaacacagagcaggaggagggcaacgagatg
gcacacgaggtggagatgactgtgaagcacagccgctttgtcaaggagacctacgacttc
gacatcgcggtgctgaggctcaagacgcccatccggttccgccggaacgtggcgcccgcc
tgcctgcccgagaaggactgggcggaggccacgctgatgacccagaagacgggcatcgtc
agcggcttcgggcgcacgcacgagaagggccgcctgtcgtccacgctcaagatgctggag
gtgccctacgtggaccgcagcacctgtaagctgtccagcagcttcaccatcacgcccaac
atgttctgcgccggctacgacacccagcccgaggacgcctgccagggcgacagtggcggc
ccccacgtcacccgcttcaaggacacctacttcgtcacaggcatcgtcagctggggagaa
gggtgcgcgcgcaagggcaagttcggcgtctacaccaaggtctccaacttcctcaagtgg
atcgacaagatcatgaaggccagggcaggggccgcgggcagccgcggccacagtgaagcc
cctgccacctggacggtcccgcccccccttccgctctga

DBGET integrated database retrieval system