KEGG   Bos taurus (cow): 280802
Entry
280802            CDS       T01008                                 

Symbol
GCG
Name
(RefSeq) glucagon precursor
  KO
K05259  glucagon
Organism
bta  Bos taurus (cow)
Pathway
bta04024  cAMP signaling pathway
bta04080  Neuroactive ligand-receptor interaction
bta04714  Thermogenesis
bta04911  Insulin secretion
bta04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    280802 (GCG)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    280802 (GCG)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    280802 (GCG)
   04922 Glucagon signaling pathway
    280802 (GCG)
  09159 Environmental adaptation
   04714 Thermogenesis
    280802 (GCG)
SSDB
Motif
Pfam: Hormone_2 Lipoprotein_10 MPM1
Other DBs
NCBI-GeneID: 280802
NCBI-ProteinID: NP_776341
BGD-bta: BT14152
Ensembl: ENSBTAG00000000730
VGNC: 29284
UniProt: P01272
Position
2
AA seq 180 aa
MKSLYFVAGLFVMLVQGSWQRSLQNTEEKSSSFPAPQTDPLGDPDQINEDKRHSQGTFTS
DYSKYLDSRRAQDFVQWLMNTKRNKNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI
AWLVKGRGRRDFPEEVNIVEELRRRHADGSFSDEMNTVLDSLATRDFINWLLQTKITDRK
NT seq 543 nt   +upstreamnt  +downstreamnt
atgaaaagcctttactttgtggctggattgtttgtaatgctggtacaaggcagctggcaa
cgttcccttcagaacacagaggagaaatccagttcattcccagctccccagaccgacccg
ctcggcgatccagatcagatcaatgaagataagcgccactcgcagggcacattcaccagt
gactacagcaagtacctggactccaggcgtgcccaggacttcgtgcagtggttgatgaat
accaagagaaacaagaataacattgccaaacgtcatgatgaatttgagagacatgctgaa
gggacctttaccagtgatgtaagttcttatttggaaggccaagctgccaaggaattcatt
gcttggctggtgaaaggccgaggaaggcgagatttcccagaagaagtcaacatcgttgaa
gaactccgccgcagacacgccgatggctctttctctgatgagatgaacactgttctcgat
agtcttgccacccgagactttataaactggttgcttcagacgaaaattactgacaggaag
taa

DBGET integrated database retrieval system