KEGG   Bos taurus (cow): 280826
Entry
280826            CDS       T01008                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6 precursor
  KO
K05405  interleukin 6
Organism
bta  Bos taurus (cow)
Pathway
bta01521  EGFR tyrosine kinase inhibitor resistance
bta01523  Antifolate resistance
bta04060  Cytokine-cytokine receptor interaction
bta04061  Viral protein interaction with cytokine and cytokine receptor
bta04066  HIF-1 signaling pathway
bta04068  FoxO signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04218  Cellular senescence
bta04620  Toll-like receptor signaling pathway
bta04621  NOD-like receptor signaling pathway
bta04623  Cytosolic DNA-sensing pathway
bta04625  C-type lectin receptor signaling pathway
bta04630  JAK-STAT signaling pathway
bta04640  Hematopoietic cell lineage
bta04657  IL-17 signaling pathway
bta04659  Th17 cell differentiation
bta04668  TNF signaling pathway
bta04672  Intestinal immune network for IgA production
bta04931  Insulin resistance
bta04932  Non-alcoholic fatty liver disease
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta05010  Alzheimer disease
bta05020  Prion disease
bta05022  Pathways of neurodegeneration - multiple diseases
bta05132  Salmonella infection
bta05133  Pertussis
bta05134  Legionellosis
bta05135  Yersinia infection
bta05142  Chagas disease
bta05143  African trypanosomiasis
bta05144  Malaria
bta05146  Amoebiasis
bta05152  Tuberculosis
bta05161  Hepatitis B
bta05162  Measles
bta05163  Human cytomegalovirus infection
bta05164  Influenza A
bta05166  Human T-cell leukemia virus 1 infection
bta05167  Kaposi sarcoma-associated herpesvirus infection
bta05168  Herpes simplex virus 1 infection
bta05169  Epstein-Barr virus infection
bta05171  Coronavirus disease - COVID-19
bta05200  Pathways in cancer
bta05202  Transcriptional misregulation in cancer
bta05321  Inflammatory bowel disease
bta05323  Rheumatoid arthritis
bta05332  Graft-versus-host disease
bta05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    280826 (IL6)
   04668 TNF signaling pathway
    280826 (IL6)
   04066 HIF-1 signaling pathway
    280826 (IL6)
   04068 FoxO signaling pathway
    280826 (IL6)
   04151 PI3K-Akt signaling pathway
    280826 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    280826 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    280826 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    280826 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    280826 (IL6)
   04620 Toll-like receptor signaling pathway
    280826 (IL6)
   04621 NOD-like receptor signaling pathway
    280826 (IL6)
   04623 Cytosolic DNA-sensing pathway
    280826 (IL6)
   04625 C-type lectin receptor signaling pathway
    280826 (IL6)
   04659 Th17 cell differentiation
    280826 (IL6)
   04657 IL-17 signaling pathway
    280826 (IL6)
   04672 Intestinal immune network for IgA production
    280826 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    280826 (IL6)
   05202 Transcriptional misregulation in cancer
    280826 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    280826 (IL6)
   05161 Hepatitis B
    280826 (IL6)
   05171 Coronavirus disease - COVID-19
    280826 (IL6)
   05164 Influenza A
    280826 (IL6)
   05162 Measles
    280826 (IL6)
   05168 Herpes simplex virus 1 infection
    280826 (IL6)
   05163 Human cytomegalovirus infection
    280826 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    280826 (IL6)
   05169 Epstein-Barr virus infection
    280826 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    280826 (IL6)
   05135 Yersinia infection
    280826 (IL6)
   05133 Pertussis
    280826 (IL6)
   05134 Legionellosis
    280826 (IL6)
   05152 Tuberculosis
    280826 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    280826 (IL6)
   05144 Malaria
    280826 (IL6)
   05142 Chagas disease
    280826 (IL6)
   05143 African trypanosomiasis
    280826 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    280826 (IL6)
   05321 Inflammatory bowel disease
    280826 (IL6)
   05332 Graft-versus-host disease
    280826 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    280826 (IL6)
   05020 Prion disease
    280826 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    280826 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    280826 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    280826 (IL6)
   04931 Insulin resistance
    280826 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    280826 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    280826 (IL6)
   01523 Antifolate resistance
    280826 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bta04052]
    280826 (IL6)
Cytokines and growth factors [BR:bta04052]
 Cytokines
  Interleukins
   280826 (IL6)
SSDB
Motif
Pfam: IL6 MAP65_ASE1 IL23 GCSF ADIP Lipoprotein_6 ZapB
Other DBs
NCBI-GeneID: 280826
NCBI-ProteinID: NP_776348
BGD-bta: BT10688
Ensembl: ENSBTAG00000014921
VGNC: 30166
UniProt: P26892
Position
4
AA seq 208 aa
MNSRFTSAFTPFAVSLGLLLVMTSAFPTPGPLGEDFKNDTTPGRLLLTTPEKTEALIKRM
VDKISAMRKEICEKNDECESSKETLAENKLNLPKMEEKDGCFQSGFNQAICLIRTTAGLL
EYQIYLDYLQNEYEGNQENVRDLRKNIRTLIQILKQKIADLITTPATNTDLLEKMQSSNE
WVKNAKIILILRNLENFLQFSLRAIRMK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaactcccgcttcacaagcgccttcactccattcgctgtctccctggggctgctcctg
gtgatgacttctgctttccctaccccgggtcccctgggagaagatttcaaaaatgacacc
accccaggcagactacttctgaccactccagagaaaaccgaagctctcattaagcgcatg
gtcgacaaaatctctgcaatgagaaaggagatatgtgagaagaatgatgagtgtgaaagc
agcaaggagacactggcagaaaataagctgaatcttccaaaaatggaggaaaaggacgga
tgcttccaatctgggttcaatcaggcgatttgcttgatcagaaccactgctggtcttctg
gagtatcagatatacctggactacctccagaacgagtatgagggaaatcaggaaaatgtc
agggatttgaggaaaaatatcagaacactgatccagatcctgaagcaaaagatcgcagat
ctaataaccactccagccacaaacactgacctgctggagaagatgcagtcttcaaacgag
tgggtaaagaacgcaaagattatcctcatcctgagaaaccttgagaatttcctgcagttc
agcctgagagctattcggatgaagtag

DBGET integrated database retrieval system