KEGG   Bos taurus (cow): 280930Help
Entry
280930            CDS       T01008                                 

Gene name
RNASE1
Definition
(RefSeq) seminal ribonuclease precursor
  KO
K01168  pancreatic ribonuclease [EC:4.6.1.18]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bta03019]
    280930 (RNASE1)
   04131 Membrane trafficking [BR:bta04131]
    280930 (RNASE1)
Enzymes [BR:bta01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.18  pancreatic ribonuclease
     280930 (RNASE1)
Messenger RNA biogenesis [BR:bta03019]
 Eukaryotic type
  mRNA degradation factors
   Other degradation factors
    RNases
     280930 (RNASE1)
Membrane trafficking [BR:bta04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    280930 (RNASE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RnaseA
Motif
Other DBs
NCBI-GeneID: 280930
NCBI-ProteinID: NP_861526
BGD-bta: BT10837
Ensembl: ENSBTAG00000025663
UniProt: P00669 W0UV03
Structure
PDB: 

Position
10
AA seq 150 aa AA seqDB search
MALKSLVVLPLLVLVLLLVRVQPSLGKESAAAKFERQHMDSGNSPSSSSNYCNLMMCCRK
MTQGKCKPVNTFVHESLADVKAVCSQKKVTCKNGQTNCYQSKSTMRITDCRETGSSKYPN
CAYKTTQVEKHIIVACGGKPSVPVHFDASV
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaagtctctagtcgtgttgccactgctggtcctggtgctgctgctggtgcgg
gtccagccttccctgggcaaggaatctgcagctgccaagttcgagcggcagcacatggac
tctggcaactcccccagcagcagctccaactactgcaacctgatgatgtgctgccggaag
atgacccaggggaaatgcaagccagtgaacacctttgtgcatgagtccctggccgatgtt
aaggccgtgtgctcccagaagaaagtcacttgcaagaatgggcagaccaactgctaccag
agcaaatccaccatgcgcatcacagactgccgcgagactggcagctccaagtaccccaac
tgcgcctacaagaccacccaggtggagaaacacatcatagtggcttgtggcggtaaaccg
tccgtgccagtccacttcgatgcttcagtgtag

DBGET integrated database retrieval system