KEGG   Bos taurus (cow): 280941
Entry
280941            CDS       T01008                                 

Gene name
TIE1
Definition
(RefSeq) tyrosine-protein kinase receptor Tie-1 precursor
  KO
K05120  tyrosine kinase receptor 1 [EC:2.7.10.1]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bta01001]
    280941 (TIE1)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     280941 (TIE1)
Protein kinases [BR:bta01001]
 Receptor tyrosine kinases (RTK)
  TIE family
   280941 (TIE1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase fn3 ig I-set Pur_ac_phosph_N Ig_3 Ig_2 EGF_2 hEGF TadZ_N Pkinase_fungal APH DUF4702
Other DBs
NCBI-GeneID: 280941
NCBI-ProteinID: NP_776390
BGD-bta: BT11866
Ensembl: ENSBTAG00000003777
VGNC: 35861
UniProt: Q06805
Position
3
AA seq 1136 aa
MVWLEPPLLLPIFFLASHVGAAVDLTLLADLRLTEPQRFFLTCVSGEAGAGRGSDAWGPP
LLLEKDDRIVRTPRPWQPPHIARNGSSRVTVRGFSQPSDLVGVFSCVGGGGTRVLYVHNS
PGAHLLPDKVTHTVNKGDTAVLSARVRKEKQTDVIWKSNGSYFYTLDRHEAQDGQFLLQL
PNVQPSSSGIYSATYLEASPLGSAFFRLIVRGCEAGRWGQDCTKECPGCLHGGVCHDQDG
ECVCPPGFTGTRCEQACREGRFGQSCQEQCPGTSGCRGLTFCLPDPYGCSCGSGWRGSQC
QEACAPGRFGADCHLQCQCQNGGTCDRFSGCVCPSGWHGMHCEKSDRIPQILDMVSELEF
NLDTMPRINCAAAGNPFPVRGSMELRKPDGTVLLSTKAIVEPDRTTAEFEVPRLALGDSG
LWECRVSTSGGQDSRRFRINVKVPPVPLTAPRLLAKQSRQLVVSPLVSFSGDGPIASVRL
HYRPQDSTMAWSTIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTTDC
PEPLLKPWLEGWHVEGPDRLRVSWSLPPVPGPLVGDGFLLRLWDGARGQERRENVSSPQA
RTALLTGLTPGTYYQLDVRLYHCTLLGPASPAARVLLPPSGPPAPRHLHAQALSDSEIQL
MWQRPEAAAGPISKYIVEVQVAGGSGDPLWMDVDRPEETSTIVRGLNASTRYLFRVRASV
QGPGDWSNVVEQSTLGNGLQIEGPVQEIHAAEEGLDQQLVLAVVGSVSATCLTILAALLT
LACIRKSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKPQPEPLNYPVLEWEDITFE
DLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNIIN
LLGACENRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFASD
AANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWMAI
ESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQAYRMEQPRNCDDEV
YELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA
NT seq 3411 nt   +upstreamnt  +downstreamnt
atggtctggctggagccccctttgctactccccatcttcttcctggcttctcatgttggg
gcggcggtggacctgacgctgctggccgacctgcgtctgaccgagccccagcgcttcttc
ctgacctgcgtgtccggggaggcgggggcgggcaggggctcggacgcctgggggccccca
ctgctgctggagaaggacgaccgcatcgtgcgcacgccgcggccctggcagcccccgcac
atcgcccgcaacggctcgagccgagtgaccgtgcgcggcttctcgcagccctccgacctg
gtgggcgtcttctcctgcgtgggcggcgggggcacgcgcgtcctctatgtgcacaacagc
cctggggcccacctgctcccggacaaggtcacacacacagtgaacaagggcgacacggct
gtactttccgcgcgagtgcgcaaggagaaacagacagatgtgatctggaagagcaacgga
tcctatttctacaccctggaccggcacgaggcccaggacgggcagttcttgctgcagctc
ccaaacgtgcagccatcgtcgagcggcatctacagtgccacatacctggaagccagccca
ctgggcagtgccttctttcgactcatcgtgcggggctgtgaggcagggcgctggggacaa
gactgtaccaaggaatgcccaggctgcctgcatggaggtgtctgccatgaccaggacggc
gagtgtgtgtgcccccctggattcactgggacccgctgtgagcaggcctgcagggaaggc
cgttttgggcagagctgccaggagcagtgcccaggcacatcaggctgccggggcctcacc
ttctgcctcccagacccctatggctgttcttgtggatctggatggagaggaagccagtgc
caggaagcctgcgccccaggtcgttttggagctgactgccacctccagtgccagtgtcag
aatggtggtacttgtgaccgcttcagcggctgtgtctgtccctccgggtggcatgggatg
cactgtgagaagtcagaccggatcccccagatcttggacatggtctcagaactggagttc
aacttagacacaatgccccggatcaactgtgccgcagcggggaaccccttcccagtccgg
ggcagcatggagctccgcaagccggatggcacggtgctcctgtccaccaaggccattgtg
gagccagatagaaccacagccgagtttgaggtgccccgcttggctcttggggacagtgga
ctctgggaatgccgcgtgtccacgtctggtggccaggatagtcgacgcttcaggatcaat
gtcaaagtgccaccagtgcccctgactgccccgaggcttctggccaagcagagccgccag
ctcgtggtctccccgctggtctccttctctggggacggacccatcgcctccgttcgcctg
cactacaggccccaggacagcaccatggcctggtctaccatcgtggtggaccccagtgag
aacgtgacgttaatgaacctgaggccgaagacgggatacagtgtccgtgtgcagctgagc
cggccgggggaagggggggagggggcctgggggcctcccaccctcatgaccacagactgt
cctgagcccttgttgaagccgtggctggagggctggcatgtggagggccccgaccggttg
cgagtgagctggtccttaccccccgtgccggggccgctggtgggcgatggtttcctgctg
cgcctgtgggacggggcccggggacaggagcggcgggagaacgtctcgtccccccaggcc
cgcaccgccctcctgaccggactcacgcctggcacctactaccagctggacgtgcggctc
taccactgcaccctcctgggcccggcctcgcccgcagcacgtgtgcttctgccccccagc
gggcccccagccccccgacacctccatgcccaggccctttcagactctgagatccagctg
atgtggcagcgccccgaggctgcagccgggcctatatccaagtacatcgtggaggtgcag
gtggcagggggctccggagacccgctgtggatggacgtggacaggcccgaggagacgagc
accatcgtccgcggccttaacgccagcacgcgctacctcttccgcgtgcgggccagtgtc
cagggccctggcgactggagcaacgtggtagaacagtccaccttgggcaacgggctgcag
attgagggcccagtccaagagatccatgcagctgaagagggcctggatcaacagctggtc
ctggctgtggtgggctctgtgtctgccacctgcctcaccatcctggctgccctcctcacc
ttggcgtgcatccgcaaaagctgcctgcatcgcagacgcaccttcacctaccagtcagga
tcgggcgaggagaccatcctgcagttcagctcaggcaccttgacactgacccggcggcca
aaacctcagcccgagcccctaaattacccagtgctggagtgggaggacatcacctttgag
gatctcattggagagggtaactttggccaggtcatccgggccatgatcaagaaggatgga
ctcaagatgaacgccgctatcaagatgctgaaagagtatgcctctgaaaatgaccatcgt
gactttgcgggagaactggaagttctgtgcaaattggggcatcatccgaacatcatcaac
ctcttgggggcctgtgagaaccgaggttacttgtatatcgccattgaatatgccccctat
gggaatctgctggattttctgcgcaaaagccgggtcctggaaactgacccagcttttgcc
cgggaacacggaacagcctccaccctcagctcccggcagctgctgcgttttgccagtgat
gctgccaatggcatgcagtacctgagtgagaagcagttcatccacagggacttggctgcc
cgaaacgtgctggtcggagagaacctggcctccaagattgcagattttggcctttctcgg
ggggaggaggtttatgtaaagaagactatggggcgtctcccggtgcgctggatggccatt
gagtctctgaactacagcgtctacaccaccaagagtgatgtttggtcttttggggtcctc
ctctgggagatcgtgagccttgggggcactccatactgcggcatgacgtgtgccgagcta
tatgagaagctgccgcaggcgtaccgcatggaacagcctcgcaactgtgacgatgaagtg
tacgagctgatgcggcagtgctggcgggaccgtccatacgagcgacccccctttgcccag
attgcgctacagctgggccgaatgctggaagccaggaaggcctatgtgaacatgtcgctg
tttgagaacttcacatatgcaggcattgacgctacagctgaggaggcctga

DBGET integrated database retrieval system