KEGG   Bos taurus (cow): 280958Help
Entry
280958            CDS       T01008                                 

Gene name
VWF
Definition
(RefSeq) von Willebrand factor precursor
  KO
K03900  von Willebrand factor
Organism
bta  Bos taurus (cow)
Pathway
bta04151  PI3K-Akt signaling pathway
bta04510  Focal adhesion
bta04512  ECM-receptor interaction
bta04610  Complement and coagulation cascades
bta04611  Platelet activation
bta05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    280958 (VWF)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    280958 (VWF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    280958 (VWF)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    280958 (VWF)
   04611 Platelet activation
    280958 (VWF)
 09160 Human Diseases
  09167 Infectious diseases
   05165 Human papillomavirus infection
    280958 (VWF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bta03110]
    280958 (VWF)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    280958 (VWF)
Chaperones and folding catalysts [BR:bta03110]
 Intramolecular chaperones
  Others
   280958 (VWF)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   280958 (VWF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWD VWA C8 VWA_N2 TIL VWC Pacifastin_I
Motif
Other DBs
NCBI-GeneID: 280958
NCBI-ProteinID: NP_001192237
BGD-bta: BT11446
Ensembl: ENSBTAG00000012265
VGNC: 36860
UniProt: P80012
Position
5
AA seq 2809 aa AA seqDB search
MFPTRLARLLLAVALTLPGALCGEGALGKSSMARCSLFGADFINTFDESMYSFSGDCSYL
LAGDCKTHSFSIVGDFQGGRRMGLSVYLGEFFDIHVFVNGTVLQGGQHVSMPYATRGLYL
ETEVGHHKLSSESYGFVARIDGSGNFQILLSDRHFNKTCGLCGDFNIFAEDDFRTQGTLT
SDPYDFANSWALSSEEQRCPRVSPPSSSCNVSSELQKGLWEKCQLLKTASVFARCHALVD
PEPFVALCERMLCACAQGLRCPCPVLLEYARACAKQGMLLYGWADHSSCRPDCPAGMEYK
ECVSPCHRTCRSLSITEVCREQCVDGCSCPEGQLLDEGRCVESTECPCVHAGKPYPPGAS
LSRDCNTCICRNSQWVCSNEDCPGECLITGQSHFKSFDDRHFTFSGVCQYLLAQDCQDHS
FSVVIETVQCADDPDAVCTRSVTVRLPSPHHGLLKLKHGGGVALDGQDIQIPLLQGDLRI
QHTVTASLQLNFGEDLQIDWDGRGRLLLKLSPVYAGRTCGLCGNYNGNQRDDFLTPAGLV
EPLVEHFGNSWKLRADCEDLQEQPSDPCSLNPRLTKFADQACAILTSPKFEACHSAVSPL
PYLRNCRYDVCACSDGRDCLCDAVANYAAACARRGVHVGWREPSFCALSCTHGQVYQQCG
TPCNLTCRSLSHPDEECTEVCLEGCFCPPGLFLDETGSCVPKAQCPCYYDGEIFQPEDIF
SDHHTMCYCEDGFMHCSTSGAPGSLLPEAVLSSPLSHRSKRSLSCRPPMVKVVCPADNPR
AEGLECTKTCQNYDLECMSTGCVSGCLCPPGMVRHENRCVALERCPCFHQGREYAPGDRV
KVDCNSCVCQDRKWNCTDHVCDASCSALGLAHYFTFDGLKYLFPGECQYVLVQDHCGSNP
GTFRVLVGNEGCSVPSLKCRKRITILVEGGEIELFDGEVNVKTPMKDETHFEVVESGRYI
TVLLGKALSVVWDGHLAVSVFLKRTYQERVCGLCGNFDGVQNNDLTSSSLQVEENPVDFG
NSWKVSPQCADTQKVRLDSAPAICHDNVMKQTMVDSSCRVLTSDVFRECNRLVNPEPYLD
VCIYDSCSCESIGDCSCFCDTIAAYAHECAQHGQVVTWRTATLCPQNCEERNLKESGYQC
EWRYNSCAPACPVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVNPEDCPVCQVE
GRRLASGKKVTLNPGDPEHCQICHCDGVSLTCEACKEPGGPPPTEGPVIPTTPYVEDIPE
PPLHDFFCSKLLDLVFLLDGSSKLSEADFETLKAFVVGMMERLHISQKRIRVAVVEYHDG
SHAYLALQDRKRPSELRRIAGQVKYAGSEVASTSEVLKYTLFQIFGRIDRPEASRVALLL
TASQEPPRLARNLVRYVQGLKKKKVSVVPVGIGPHASLKQIRLIEKQAPENKAFVLSGVH
ELEQRMDDIVGYLCDLALEVPAPTLTQHPLAAQVTVAPQLLGPSLPGPKRSSVVLDVAFL
LEGSDEVGEANFNRSAEFVEEVIRRMDVGQDGIHVTVLQYSYVVTVEHSFREPQSKDVVL
QRLREVRYRGGNQTNTGLALQYLSEHSFSASQGDREQAPNLVYMVTGSPASDKIQRMPGD
IQLVPIGVGPRVDVQELERVSWPQTPIFIQDFERLPREAPDLVLQRCCSEDGPHLPTLAP
APDCSQPLDVVLLLDGSSTSPASYFDEMKSFAKAFISKANLGPQLTQVSVLQYGSNTNVD
VPWDIHVDKAHLLSLVDPMHREGGPSQVGNALSFAARYITSQVHGARPSASKVVVILVTG
SSMDSVEAAAAAARSNRVAVFPIGIGDQYDAAQLRVLAGPGASSNVAELQRIEDLPSMVA
LGNSFFQRLCSGFVSVCVDEDGNERRPGDVWTLLDQCHTVTCLPDGQTLLKSHRVNCDQG
PQPSCPDGQTPLRMEEACGCRWACPCVCTGSSTRHIVTFDGRNFKLTGNCSYVLFHNKEQ
DLEVILHNGFCSAGARQACMKSVEVKQNGLSVELRSNMEVMVNGRLVSVPYLGGDMEVRV
YGTIMFEVRFMGHILSFTPQNNEFQLQLRPKIFASKTYGLCGFCDENGANDFMLRDGTVT
EDWKTLVREWTVQQPGQTCPLGPEEPCPISQGSRCQVLLSELFAECHKVLAPATFHAMCQ
QDSCQQEQVCEAIASYAHLCRTKGVCVDWRTPDFCAVSCPPSLIYNHCESGCPRQCEGNS
SSCGDHPLEGCFCPPHQVMLEGSCVPEEACTQCVGDDGIRHQLLETWVPDHQPCQICTCL
SGRKVNCTTQPCPSAGVPTCGPCEVARLRQSTQQCCPEYECVCDLVSCDVPPVPNCEDGL
QPVLANPGECRPSFTCVCRKEECPKGSPPSCPPHRMPALRKTRCCDEYECACNCTNSTVS
CPLGYLASTITNDCSCTTTTCLPDKVCVHRGTIYPVGQFWEEGCDTCTCTDLEDAVMGLR
VAQCSQKPCADICRPGFTYVLREGECCGRCLPSACEVVTGSPRGDSQTQWKSVGSHWASP
ENPCLIHECVRVEEEVFVQQRNVSCPQLNVPVCPLGFQLRCQTLGCCPTCRCEPVQACVL
NGTIIGPGKTVMVDACMTCRCHVQAGVISGFKLECRKTTCQACPAGYMEEKLQGECCGRC
LPTACTIQLRGGQIMMLKRDETLQDGCDSHFCKVNKRGEFIWEKRVMSCPPFNEHKCLAE
GGEIMKIPGTCCDTCEEPECKDITARVKSIKVGDCKSEDEVDIHYCQGRCTSKALYSIDT
EDVQDQCSCCSPTRTEPMPVPLRCTNGSIIHHVVLNALQCQCSSRKCSP
NT seq 8430 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccaccaggctcgcgaggctgctgcttgctgtggccctcactttgccaggggcc
ctttgtggagaaggggctcttggcaagtcatcgatggcccggtgcagcctcttcggagct
gacttcatcaacacctttgatgagagcatgtacagcttctcgggagactgcagttacctc
ctggcaggggattgcaagacacactccttctcaatcgtaggggacttccaaggtggtaga
agaatgggtctctcggtgtacctaggggaatttttcgacatccatgtgtttgtcaacggt
accgtgctgcaggggggccagcacgtctccatgccctatgccaccagagggctatacctg
gagaccgaggttgggcaccacaagctgtccagcgagtcgtatggctttgtggccaggatc
gacggcagcgggaacttccaaatcctgctgtcggacagacacttcaacaagacctgtggg
ctgtgcggtgactttaacatctttgccgaagatgacttcaggactcaaggaaccctgacc
tcagacccgtacgactttgcaaactcctgggccctgagcagtgaggagcagcggtgccca
cgggtgtcccctcccagcagctcctgcaacgtctcctccgagctgcagaagggcctgtgg
gagaagtgccagcttctgaagacggcctccgtgttcgcccgctgccacgccctggtggac
cccgagccttttgtggccctgtgtgagcggatgctgtgcgcatgcgcccaggggctgcgg
tgcccctgccctgtgctcctggagtacgcccgcgcctgcgccaagcaggggatgctgctg
tacggctgggcggaccacagctcctgccgaccagactgccccgcgggcatggagtacaag
gagtgtgtgtccccatgccacaggacctgccggagcctgagtatcaccgaagtgtgtcgg
gagcagtgtgtggatggctgcagctgccctgagggacagctcctggatgaaggccgctgt
gtggaaagtactgagtgtccctgtgtgcatgctggaaagccataccctccaggagcctcc
ctctcacgagactgcaacacctgcatctgccgaaacagccagtgggtctgcagcaatgag
gactgtccaggagagtgtctcatcacaggacaatcccacttcaagagctttgacgacagg
cacttcaccttcagcggggtctgccagtacctgctggcccaggactgccaggatcactcc
ttctccgtcgtcatagagactgtccagtgtgccgacgaccctgatgcggtctgcacccgc
tccgtcaccgtccgcctgcccagcccgcaccacggcctcctgaagctgaagcacgggggt
ggagtcgccctggacggccaggatatccagattcccctcctgcaaggtgacctccgcatc
cagcacactgtgacggcctccctgcagctcaacttcggggaggacctgcagatagactgg
gacggccgtgggaggctgctgctgaagctgtcccctgtctacgcggggaggacatgcggg
ctgtgcgggaattacaacggcaaccagagggacgacttcctgacgcccgcgggcctggtc
gagcccctggtggagcacttcggaaactcctggaagctgcgcgcagactgtgaggacttg
caggagcagcccagtgacccctgcagcctcaatccgcgcctgaccaagttcgcagaccag
gcctgcgccatcctgacgtcccccaagttcgaggcctgccacagcgccgtgagcccgctg
ccctacctgcgcaactgccgctacgacgtgtgcgcctgctccgacggcagagactgcctg
tgcgacgcggtggccaactacgcagcggcctgcgcccggaggggcgtgcacgtcggatgg
cgggagcccagcttctgtgcgctgagctgcacacacggccaggtgtaccagcagtgtggg
accccctgcaacctcacctgccgctcactctcccacccggacgaggaatgcaccgaggtc
tgtctggagggctgcttctgcccgccagggctcttcctggacgagacagggtcctgtgtg
cccaaggcccagtgcccctgttactacgacggtgagatcttccaacccgaagacatcttc
tcggaccatcacaccatgtgctactgcgaagatggcttcatgcactgctccacgagtgga
gccccagggagcctgctgcctgaagcagtcctcagcagccccctgtcccaccgcagcaaa
aggagcctgtcctgccggccccccatggtcaaggtggtgtgccctgctgacaacccgagg
gccgaagggcttgaatgcaccaaaacctgccagaactatgacctggaatgcatgagcact
ggctgtgtgtccggctgcctctgccccccgggcatggtccggcatgagaacaggtgtgtg
gccctggaaaggtgcccttgcttccaccagggcagagagtatgcccccggagacagggtg
aaggtcgattgcaacagctgcgtctgtcaggaccggaagtggaactgtacggaccacgtg
tgtgatgctagctgctctgccctgggcctggctcactacttcacctttgatgggctcaag
tacctgttcccgggggagtgccagtatgtcctggtgcaggaccactgtggtagtaacccc
ggcaccttccgggtcctggtggggaatgaggggtgcagcgtcccctccctgaagtgcagg
aagcgcatcaccatcctggtggaaggaggagaaatagagctgtttgacggggaggtgaac
gtgaagacgcccatgaaggatgagacacactttgaggtggtggagtctggccggtacatc
actgtgctgctgggcaaggccctctctgtggtctgggacgggcacctggccgtctccgtg
ttcctgaagcggacgtaccaggagcgggtatgcggcctgtgtgggaatttcgatggcgtc
cagaacaatgacctcaccagcagcagcctccaagtggaggaaaaccccgtggactttggg
aattcctggaaagtgagcccacagtgtgctgacacccagaaagtgcggctggactcggcc
cctgccatctgccatgacaacgtcatgaagcagaccatggtggattcctcctgcagggtc
ctcaccagtgatgttttccgagagtgcaacaggctggtgaaccccgagccgtacctggat
gtttgcatctatgacagctgctcctgcgagtccatcggggactgctcctgcttctgtgac
accatcgctgcctatgcccatgagtgtgcccagcacggccaggtggtgacctggaggaca
gccacactgtgcccccagaattgtgaggagcggaacctgaaggagagtgggtaccaatgc
gagtggcgctacaacagctgtgctccggcctgtccagtcacgtgccagcacccggagccc
ctggcctgccccgtgcagtgcgtggagggctgccacgcacactgcccacccgggaaaatc
ctggacgagcttttgcagacctgcgtcaaccccgaggactgccctgtgtgccaggtggag
ggccggcgcttagcctccgggaagaaagtgaccctgaaccctggggaccctgagcattgc
cagatctgtcactgtgatggtgtcagcctcacttgtgaagcctgcaaggagccaggaggc
ccgccccccaccgaaggcccggtcatccccacaaccccatatgtggaggacatcccggag
ccgcccctgcatgacttcttctgcagcaaactcctggacctggtcttcctgctggatggc
tcctccaagctgtccgaggctgacttcgagacgctgaaggcattcgtggtgggcatgatg
gagcgtctgcacatttcccagaaacgcatccgtgtggccgtggtggagtaccatgatggc
tcccatgcctacctcgcgctgcaagaccggaaacggccatctgagcttcggcgcattgcc
gggcaggtgaagtatgcgggcagcgaggtggcttccaccagcgaggtcttgaagtacacg
ctcttccagatcttcggcaggattgaccggcctgaggcctctcgcgtggccctgctgctt
acggccagccaggaaccccccaggctggcccggaacttggtccgctacgtccagggcctg
aagaagaagaaggtctccgtggtccccgtgggcatcgggccccacgccagcctcaagcag
atccgcctcattgagaagcaggcacctgagaacaaagcctttgtgctaagtggcgtgcac
gagctggagcagcggatggacgatattgtcggctacctctgcgacctcgccctcgaggtg
cctgccccgaccctgacgcaacatcccctcgccgcacaggtcactgtggcgccgcagctc
ctgggtccttcgctgccgggacccaagaggagctctgtggtcctggatgtggcattcctc
ctggaaggctcggacgaggtgggcgaggccaacttcaacaggagcgcagagtttgtggag
gaggtgatccgacgcatggacgtgggccaggacggcatccacgtcacagtgctgcagtac
tcatatgtggtgactgtggagcactccttcagggagccacagtccaaggacgtggtcctg
cagcgactccgtgaagtccgctaccgaggtggcaaccagacaaacacggggctggccctg
cagtacttgtcggagcacagcttctctgccagccagggggaccgggagcaggcgcccaac
ctggtctacatggtgacaggaagcccggcctcggacaagatccagcggatgcctggagac
atccagctggtgcccatcggcgtgggcccccgcgtggatgtgcaggagctggagagggtc
agctggccccagacccccatcttcatccaggacttcgagaggctcccccgagaagctcca
gatctggtgctgcagcggtgctgctccgaagacggcccgcacctccccaccctcgcccct
gccccagactgcagccagcccctggatgtagttctcctcctggatggctcctccacctct
ccagcctcttactttgacgaaatgaagagtttcgccaaggcgttcatctcaaaagccaac
ctaggccctcagctcacccaggtgtcggtcctgcagtacggaagcaacaccaacgttgac
gtgccctgggacatacacgtggacaaagcccacctgctgagccttgtggaccccatgcat
cgcgagggaggccccagccaagttggtaacgcactgtccttcgcggcacgctacatcacg
tcccaagtccacggtgccaggcccagtgcctccaaggtggtggtgatcctggtcacaggc
tcctccatggattcagtggaggcggccgccgctgctgccagatccaaccgagtggctgtg
ttccccatcgggattggggaccagtatgatgcagcccagctgagggtcttggcgggtccg
ggggccagctccaacgtggcagagctccagcggatcgaagacctccccagcatggttgcc
cttggcaactctttcttccagaggctatgctctgggttcgtcagtgtttgcgtggatgag
gacgggaatgagaggaggcctggggacgtctggaccttgctggatcagtgccacacggtg
acttgcctgccagatggccagaccttgctgaagagtcaccgggtcaactgcgatcagggg
ccacagccatcatgccccgacggccagaccccgctcaggatggaggaagcctgtggctgc
cgctgggcctgtccctgtgtgtgcacaggcagctccactcggcacatcgtgacctttgat
ggacggaatttcaagctgaccggcaactgctcatatgttctgtttcacaacaaggagcag
gacttggaggtgattctccataatggattctgcagcgctggggcgaggcaggcctgcatg
aaatctgtggaggtgaagcagaacggcctctcggttgagctccgcagcaacatggaggtg
atggtgaatgggagactggtctctgtcccttacctgggtggggacatggaggtcagagtc
tatggtaccatcatgttcgaggtcagattcatgggccacatcctctccttcaccccacaa
aacaacgagttccagctgcagctgaggcccaagatctttgcctcaaagacgtatggtctc
tgtgggttctgtgatgagaacggggccaatgacttcatgctgagggatggcacggtcact
gaggactggaagacactggtccgggagtggacggtgcagcagccggggcagacatgcccg
ctgggccccgaggagccgtgccccatctcccagggctcccgctgccaggtcctcctctct
gagctatttgctgagtgccacaaggtccttgctccagccacatttcatgccatgtgccag
caggacagttgccagcaggagcaagtgtgtgaagccattgcctcttatgcccacctctgc
cggaccaagggggtgtgtgtcgactggaggactcctgatttctgtgctgtgtcctgcccg
ccctccctgatctacaaccactgtgagagtggctgcccccggcagtgtgagggcaactcg
agctcctgcggggaccatcccttggaaggctgcttctgccctccgcaccaagtgatgctg
gaaggcagctgtgtccctgaggaggcctgtacccagtgcgtcggtgacgatggcatccgg
caccagctcctggaaacgtgggtcccagaccatcagccctgccagatctgcacgtgcctc
agcgggcggaaggtcaactgcacgacacagccctgcccctcggccggagtgcccacgtgc
ggcccatgtgaggtggcccggctccggcagagcacgcagcagtgctgtcccgagtacgag
tgtgtgtgtgacttggtgagctgtgacgtgcccccggtgcctaactgcgaagacggcctc
cagccggtgctggccaatcctggcgagtgcagacccagcttcacctgtgtctgcaggaag
gaggaatgcccgaaggggtccccaccctcctgccccccgcaccggatgcccgcccttcgg
aagacccggtgctgtgacgagtacgagtgtgcttgcaactgcaccaactccacggtgagc
tgcccgctggggtacctggcctccaccatcaccaacgactgcagctgcaccaccaccacc
tgcctccccgacaaggtgtgcgtccaccgaggcaccatctaccccgtgggccagttctgg
gaggagggctgtgatacctgcacctgcacggatctggaggatgctgtgatgggcctgcgc
gtggcccagtgctcccagaaaccctgcgcggacatctgccggccgggcttcacctacgtc
ctccgcgagggagagtgctgtggaaggtgcctgccgtcggcctgcgaggtggtgaccggc
tccccgcggggggactcccagacccagtggaagagtgttggctctcactgggcctccccc
gagaacccctgcctcatccacgagtgcgtccgagtcgaggaggaggtcttcgtgcagcag
aggaatgtctcctgcccgcagctgaatgtccccgtctgcccgttgggcttccagctgcgc
tgtcagaccttgggctgttgccccacctgtcgctgcgagcccgtgcaggcttgcgtcctc
aacggcaccatcatcgggcccgggaagactgtgatggttgacgcatgcatgacctgccgc
tgccacgtccaggcaggggtcatctctggattcaagctggagtgcaggaagaccacctgc
caggcctgccctgcgggttacatggaagagaagctccagggcgaatgctgtgggagatgc
ctgcctacggcgtgcaccattcagctacgagggggacagatcatgatgctgaagcgtgat
gagacactccaggatggctgtgacagtcacttctgcaaagtcaacaagagaggagagttc
atttgggagaagagggtcatgagctgcccgcccttcaacgaacacaaatgcctggctgag
gggggggaaatcatgaaaatccctggcacgtgctgtgacacatgtgaggagcctgagtgc
aaggacatcacagccagggtgaagtccatcaaggtgggagactgcaaatctgaagatgaa
gtggacattcactactgccagggaagatgcaccagcaaagccctgtactccatcgacacg
gaggatgtgcaggaccagtgttcctgctgctcgccgacgcgcacggagcccatgccagtg
cccctgcgctgcaccaacggctccatcatccaccatgtggtcctcaacgccctgcagtgc
cagtgctcctccaggaaatgcagcccgtga

DBGET integrated database retrieval system