KEGG   Bos taurus (cow): 280960Help
Entry
280960            CDS       T01008                                 

Gene name
XDH
Definition
(RefSeq) xanthine dehydrogenase/oxidase
  KO
K00106  xanthine dehydrogenase/oxidase [EC:1.17.1.4 1.17.3.2]
Organism
bta  Bos taurus (cow)
Pathway
bta00230  Purine metabolism
bta00232  Caffeine metabolism
bta00983  Drug metabolism - other enzymes
bta01100  Metabolic pathways
bta04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    280960 (XDH)
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    280960 (XDH)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    280960 (XDH)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    280960 (XDH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    280960 (XDH)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     280960 (XDH)
   1.17.3  With oxygen as acceptor
    1.17.3.2  xanthine oxidase
     280960 (XDH)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   280960 (XDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Motif
Other DBs
NCBI-GeneID: 280960
NCBI-ProteinID: NP_776397
Ensembl: ENSBTAG00000012519
VGNC: 36984
UniProt: P80457
Structure
PDB: 

Position
11
AA seq 1332 aa AA seqDB search
MTADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDR
LQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGI
VMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAKNGGCCGGNGNNPNCC
MNQKKDHTVTLSPSLFNPEEFMPLDPTQEPIFPPELLRLKDVPPKQLRFEGERVTWIQAS
TLKELLDLKAQHPEAKLVVGNTEIGIEMKFKNQLFPMIICPAWIPELNAVEHGPEGISFG
AACALSSVEKTLLEAVAKLPTQKTEVFRGVLEQLRWFAGKQVKSVASLGGNIITASPISD
LNPVFMASGTKLTIVSRGTRRTVPMDHTFFPSYRKTLLGPEEILLSIEIPYSREDEFFSA
FKQASRREDDIAKVTCGMRVLFQPGSMQVKELALCYGGMADRTISALKTTQKQLSKFWNE
KLLQDVCAGLAEELSLSPDAPGGMIEFRRTLTLSFFFKFYLTVLKKLGKDSKDKCGKLDP
TYTSATLLFQKHPPANIQLFQEVPNGQSKEDTVGRPLPHLAAAMQASGEAVYCDDIPRYE
NELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSADDIPGSNETGLFNDETVFAKDTV
TCVGHIIGAVVADTPEHAERAAHVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGDLK
KGFSEADNVVSGELYIGGQDHFYLETHCTIAIPKGEEGEMELFVSTQNAMKTQSFVAKML
GVPVNRILVRVKRMGGGFGGKETRSTLVSVAVALAAYKTGHPVRCMLDRNEDMLITGGRH
PFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFHMDNCYKIPNIRGTGRL
CKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKEGDLTHFNQRLE
GFSVPRCWDECLKSSQYYARKSEVDKFNKENCWKKRGLCIIPTKFGISFTVPFLNQAGAL
IHVYTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYISETSTNTVPNSSPTAAS
VSTDIYGQAVYEACQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVSLSTTGFYRTPNLGY
SFETNSGNAFHYFTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFV
QGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPTEFRVSLLRDCPNKKAIYASKAVG
EPPLFLGASVFFAIKDAIRAARAQHTNNNTKELFRLDSPATPEKIRNACVDKFTTLCVTG
APGNCKPWSLRV
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagatgaattggttttctttgtgaatggcaaaaaggtggtggagaaaaatgca
gatccagaaacaacccttttggcctacctgagaagaaagttggggctgagaggaaccaag
ctgggctgtggagaagggggctgtggggcttgtacagtgatgctttccaagtatgatcgt
ctccaagacaagatcatccacttttctgccaatgcctgcctggctcccatctgcaccttg
caccacgtggctgtgacgactgtggaaggaattggaagcaccaagacgaggctgcatcct
gtgcaggagagaatcgccaaaagtcacggctctcagtgtgggttctgcacccccggcatc
gtcatgagcatgtacacactgcttcggaatcagcccgagcccactgttgaagaaatcgag
gatgctttccaaggaaacttatgccgctgtacaggctacagacccatcctccagggcttc
cggacctttgccaagaatggtggatgctgtggaggaaatgggaacaacccaaactgctgc
atgaaccagaagaaagaccacaccgttactctctcaccatctttattcaacccagaggag
ttcatgcccctggatcctacccaggaacccatcttccctccagagttgctgaggctgaaa
gacgttccaccgaagcagctgcgttttgaaggggagcgtgtgacctggatccaagcctcc
accttgaaggagttgctggacctcaaagctcagcatcccgaggccaagctggtggtgggg
aacacagagatcggcattgagatgaagtttaagaatcagctatttcctatgatcatctgc
ccagcctggatccctgagctgaatgcagtggagcacggacctgaggggatctcctttgga
gctgcttgtgccctgagctctgtggaaaagaccctgctcgaggccgttgccaagcttccc
acccagaaaacggaggtgttcagaggagtcctggagcagctgcgctggttcgctgggaag
caggtcaagtctgtggcgtcccttggagggaacatcatcacagccagccccatctctgac
ctcaaccctgtgttcatggccagtgggaccaagctgaccatcgtgtccagaggcaccaga
agaacagttccaatggaccacaccttcttccccagctacagaaagaccctgctgggtcca
gaggagatactgctctccattgagatcccctacagcagggaggatgagtttttctcagca
ttcaagcaggcaagccggagagaagatgacatagccaaggtgacctgcggcatgagagtc
ctgttccagccaggaagcatgcaggtaaaggagctagccctctgctatggcggaatggcg
gacagaaccatctcagccctcaagaccacgcagaagcagctgtcaaagttctggaatgag
aagctgctacaggacgtgtgtgcaggcctggcggaagaactgtccttatccccagacgcc
cctggaggcatgattgaattccgacgcaccctcaccctcagcttcttcttcaagttctac
ctgacagtactgaagaaactgggcaaggactcgaaagataagtgtggtaaactggacccc
acctacaccagcgccactttactctttcagaaacaccctccagccaacatccagctcttc
caagaggtgcccaatggtcagtccaaggaggacacagtgggccggcccctgccccacctg
gccgcggccatgcaagcctctggggaggccgtatactgtgacgacatccctcgctacgag
aatgagctgttcctccggctggtcaccagcacccgggcccacgccaagatcaagtccatt
gatgtttcagaagctcagaaagtgccaggatttgtttgctttctctctgctgatgatatt
cccgggagtaatgaaaccggactctttaatgatgagacagtctttgcgaaggatacggtg
acttgtgttggtcacatcattggtgctgtggtcgctgacaccccagaacatgcagagaga
gctgcccatgtagtgaaagtcacctatgaggatcttcctgccattatcacaattgaggat
gctataaaaaataattccttttatggatctgagctgaagattgagaaaggagacctcaag
aaggggttttcagaagcagataatgtggtttcaggtgagctgtacattggtggccaagac
cacttctacctggagactcactgcaccattgctatcccgaaaggcgaggaaggggagatg
gagctctttgtgtccacacagaatgccatgaaaacccagtcctttgttgcaaaaatgttg
ggggttccagtaaaccggattttggtccgagtgaagagaatgggaggaggctttggaggg
aaggagacccggagcaccctggtgtctgtggctgtggccctggctgcatacaagactgga
cacccggtgcgctgcatgctggatcgtaatgaggatatgctgataactggcggcagacac
cccttcttggccagatacaaggttggcttcatgaagacagggacgattgtggctctagag
gtggatcactacagcaatgccgggaacagccgggacctctctcacagtataatggaacga
gctctattccacatggacaactgctataaaatccccaacatccggggcactgggcggctg
tgcaagaccaacctgtcctccaacacggccttccggggctttggggggccccaggctctg
ttcattgccgagaactggatgagcgaagttgcagtgacctgtgggctgcctgcagaggaa
gtgcggtggaagaacatgtacaaagaaggggacctgacccacttcaaccagaggcttgag
gggttcagcgtgcccaggtgctgggatgagtgcctgaagagctctcagtattacgctcgg
aagagtgaggtcgacaagttcaacaaggagaattgttggaaaaagagaggattgtgcata
attcctaccaaatttggaataagcttcacagttccttttctaaatcaggcaggagccctg
atccacgtatacacagatggctccgtgctggtgagccacgggggcacagagatgggccaa
ggccttcacaccaagatggtgcaggtggccagcaaagctctgaagatccccatctctaag
atctatatcagcgagacgagcactaacacggtgcccaactcctctcccacggccgcctcc
gtcagtaccgacatctatggacaggccgtctatgaagcttgccagaccatcctgaaaagg
ttggaacccttcaagaaaaagaatcctgatggctcctgggaagactgggtcatggctgcc
taccaggatagagtgagcttatctaccactgggttttacaggacacccaaccttggctac
agctttgagaccaactcagggaatgccttccactatttcacctacggggtggcttgctca
gaagtggaaattgactgtttgacaggggatcataagaacctccgtacagacattgtcatg
gatgttggctccagtctgaaccctgccatcgatattggacaggtggaaggggcgtttgtc
cagggcctgggcctcttcaccctggaggagctacactattcccctgaggggagcctgcac
acccgcggccccagcacctacaagatccccgcgtttggcagcatccccacagagttcagg
gtgtccctgcttcgcgactgccccaacaagaaggccatctatgcctccaaggcggtcggg
gagccgcccctcttcctgggcgcctccgtcttctttgccatcaaggatgccatccgcgcg
gctcgagctcagcacacaaataataacacgaaggagctcttccggctagatagccctgcc
accccggagaagatccgcaatgcctgcgtggacaagttcaccactctgtgtgtcactggt
gcaccaggaaactgtaaaccctggtctctgagggtctga

DBGET integrated database retrieval system