KEGG   Bos taurus (cow): 280968
Entry
280968            CDS       T01008                                 

Gene name
TPPP
Definition
(RefSeq) tubulin polymerization-promoting protein
Organism
bta  Bos taurus (cow)
SSDB
Motif
Pfam: p25-alpha DUF1018 Radical_SAM
Other DBs
NCBI-GeneID: 280968
NCBI-ProteinID: NP_776401
BGD-bta: BT20541
Ensembl: ENSBTAG00000047116
VGNC: 36258
UniProt: Q27957
Position
20
AA seq 218 aa
MADSRPKPANKTPPKSPGEPAKDKAAKRLSLEAEGAGEGAAAAGAELSALEEAFRKFAVH
GDARASGREMHGKNWSKLCRDCQVIDGRSVTVTDVDIVFSKIKGKSCRTITFEQFKEALE
ELAKKRFKDKSAEEAVREVHKLIEGKAPIISGVTKAISSPTVSRLTDTSKFTGSHKERFD
PSGRGKGRAGRVDLVDESGYVPGYKHAGTYDQKVQGGK
NT seq 657 nt   +upstreamnt  +downstreamnt
atggctgacagcaggcccaagcccgccaacaagacgccccccaagtccccgggggagccc
gccaaggacaaggcagccaaaaggctgtcgctcgaggcggaaggggccggcgagggggcg
gccgcggcgggcgcggagctgagcgccctggaggaggccttccggaagttcgcggtgcac
ggggacgcccgggcgtcgggccgggagatgcacggcaagaactggtccaagctgtgccgg
gactgccaggtgatcgacggccggagcgtgaccgtcactgacgtggacatcgtcttcagc
aagatcaagggcaagtcctgcaggaccatcacgtttgagcagttcaaggaggcgctggag
gagctcgccaagaagagattcaaagacaagagcgcggaggaggctgtcagggaggtgcac
aagctcatcgagggcaaggcccccatcatctcgggggtgacgaaagccatctcctcgccc
actgtgtcacggctcacggacaccagcaagttcacgggctcccacaaggagcgctttgac
ccgtcaggcaggggcaagggccgggcgggccgcgtggacctcgtggatgagtcgggctac
gtgccgggctacaagcacgcgggcacctatgaccagaaggtgcaggggggcaagtag

DBGET integrated database retrieval system