KEGG   Bos taurus (cow): 281039Help
Entry
281039            CDS       T01008                                 

Gene name
CAST
Definition
(RefSeq) calpastatin isoform I
  KO
K04281  calpastatin
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    281039 (CAST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calpain_inhib
Motif
Other DBs
NCBI-GeneID: 281039
NCBI-ProteinID: NP_001025489
BGD-bta: BT19504
Ensembl: ENSBTAG00000000874
VGNC: 26790
UniProt: F1MR96
Position
7
AA seq 799 aa AA seqDB search
MSQPGPKPAASPRPRRAARHTQEHVSRKTSGSPSKSGEKKGSDEKKATSLGSSQLSRTQA
DEKALVPKVTTSSASASKSSSMNPTEAKAIPGSKQLEGPHSPNKKRHKKQAVKTEPEKKP
QSSKPSVVHEKKTQEVKPKEHTEPKSLPKHSSDTGSKHAPKEKAVSKSSEQPPSEKSTKP
KTKSQDKISGGGKSTVPAAAAAASAEPADKNKENKLLTSAVPAESKPSKPSGKSDMDTAL
DDLIDTLGEPEEMKEDNTTYTGPEVSDPMSSTYIEELGKRESTLPPKYKELLNKEEGIAG
PPPDSLKPLGPNDAIDALSSDFTCSSPTADAKKTEKEKSTEEALKAQSAGVIRSAAPPQE
KKRKVEKDAMTEHALEALSASLGTRKPEPELDPSSIKEVDEAKAKEEKVKKCGEDEETVP
SEYRLKPATDKDGKPLLPEAEEKPKPLSESELIDELSEDFDQSKCKEKQSKPTEKTEASP
AAAPVPVAEDVPRTSMCSVQSAPPTAAPVKGMVPDDAVEALAGSLGKKEADPEDGKPVED
KVKEKAKEEDREKLGEKEETIPPDYRLEEAKDKDGKPLLPKEVKEPLPPLSEDVLLDALS
KDFTVPSDTSSPQFEDAKLSAVVSEVVSQTPAPTTQAAGPPPSTAQRDNKELDDALDQLS
DSLGQRQPDPDENKPVEDKVKEKAKAEHRDKLGERDDTIPPKYQHLLDDNKEGTPGKPKA
SEKPKASEKPAGAQDPIDALSGDFDSCPSTTETSTDTPKDKDKKPASSAEAPRNGGKAKD
STKAKEETSKPKADGKSTS
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagccgggcccgaagcccgccgcctccccgcggccccggcgcgctgcccgccac
acccaggagcatgtcagtagaaaaaccagtggatcgccttccaagtcaggagaaaagaaa
ggatcagatgagaaaaaagcaacaagccttgggagcagtcagctctccagaactcaggct
gatgaaaaagccctggtccccaaggtaactacttcctctgcgtcagccagcaagtcttcc
agtatgaatcccacagaagccaaggctattccaggcagcaaacagctggaaggaccgcat
tctcctaacaagaaaagacacaaaaaacaggctgtaaaaacagaacctgagaagaagcca
caatcatctaagccatctgtggttcatgagaaaaaaacccaagaagtaaagccaaaggaa
cacacagagccaaaaagcctacccaagcactcatcagatacaggaagcaagcatgctcct
aaggaaaaagccgtttccaaatcaagtgagcagccaccatcagagaaatcaacaaaacca
aagaccaagtcacaggacaagatctccggtggtggaaagagcactgttcctgctgctgct
gctgcagcatctgccgaaccagctgacaagaataaagaaaataaattgttaacatcggcc
gtaccagctgaatctaaaccaagtaaaccatctggaaagtcagacatggacactgctctg
gatgacttaatagacactttaggagaacctgaagagatgaaagaagataacacaacatat
accggaccggaagtgtcggatccaatgagttctacctacatagaggaactgggtaaaaga
gaatccacacttcctccaaaatataaggaacttctgaataaagaagaagggatcgcaggg
cctcctccagactccttgaaacccctggggcccaatgatgccatcgatgccttgtcatcc
gacttcacctgcagttcccctacagctgatgcaaagaaaactgagaaagagaaatctaca
gaagaggctttaaaagctcagtcagctggggtgatcagaagtgctgctccaccccaagag
aaaaaaaggaaagtggaaaaggatgccatgactgagcacgccctggaggccctgtcagcc
tccctgggcacccggaagccggagccggagctcgaccccagctccattaaggaggtcgat
gaggcaaaagccaaagaagagaaagtaaagaaatgtggtgaagatgaggaaacagtccca
tcggagtacagattaaaaccggccacagataaagatggaaaaccactcttgccagaggct
gaagaaaaacccaagcccctgagtgaatcagaactcatcgatgaactctcagaagatttt
gaccagtctaagtgtaaagaaaaacaatctaagccaactgaaaaaacagaggcatccccg
gccgctgcccctgtacccgtggcagaggacgtgcctcggacctctatgtgttccgtgcag
tcggctccgcccacagcagctccagtgaagggcatggtgccagacgatgctgttgaagcc
ttggctggaagcctgggcaaaaaggaagcagatccagaagacggaaagcctgtggaggat
aaagtcaaggaaaaagccaaagaagaggatcgtgagaaacttggtgaaaaagaagaaacg
attcctcctgattacagattagaagaagccaaggataaagacggaaaaccactgctgcca
aaagaggtcaaggaaccgctcccacccttgagtgaagacgtcctcctcgatgctctgtcc
aaggacttcactgtcccctcagacacatcatcgcctcaatttgaagatgctaaactttca
gctgtcgtctctgaagtggtttcccaaaccccagctccaaccacccaggcagccggtcca
ccccccagcactgcgcagcgtgacaacaaagaacttgacgatgccctggatcaactttct
gacagtctcgggcaaagacagcctgatccagatgagaataaacccgtagaggataaagtc
aaggaaaaagccaaagctgaacacagagacaagctgggagaaagagatgacaccatccca
cctaaataccaacatcttttggatgacaacaaggagggcacacccgggaagccaaaggca
tcagagaagcccaaggcatcagagaaacctgcaggtgcccaggaccccattgatgccctc
tcaggggactttgacagctgtccctcgactacagaaacctcgacagacacaccaaaggac
aaagacaagaagcctgcttccagtgccgaagcacctaggaatggcgggaaagcaaaggat
tccacaaaggcaaaggaggaaacttccaagccaaaagctgatggaaaaagtacaagttaa

DBGET integrated database retrieval system